SKU: 89128272970

EPHB3 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB3 ProteinProduct Specification Species Human Synonyms ETK2, HEK2, TYRO6 Accession P54753 Amino Acid Sequence K596 V998(end)

Product Specification


Species Human
Synonyms ETK2, HEK2, TYRO6
Accession P54753
Amino Acid Sequence

K596-V998(end)

KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, 0.1mM PMSF, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89128272970

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
pjenn
Dallas, US
★★★★★ 5
I planted the seeds, and flowers bloomed!
Size: 1-Pack, Style: Zinnia Dahlia, Size: 1-Pack, Style: Zinnia Dahlia
They came up and grew! Flowered bright pink color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
T
Verified Purchase
Tenwinkel
Birmingham, US
★★★★★ 5
Will Buy Again
Size: 1-Pack, Style: Zinnia Dahlia
We planted these for Mother's Day in my 4K classroom. They grew increadibly fast, hardy, and were beautiful when sent home with the children.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
K
Verified Purchase
Kyle Fiala
Battle Creek, US
★★★★★ 5
Liked so much, I bought TWICE!
Color: 23 - Ice Blue, Size: Twin
These sheets are such a great quality for the price. They feel soft and comfortable right out of the package and make the bed feel so much more cozy. I’ve washed them multiple times and they still feel great with no fading or pilling. The fit is also excellent — the fitted sheet stays securely in place and doesn’t slide off the corners during the night. I was so happy with the comfort and overall quality that I ended up purchasing a second set. Definitely worth the money and I would highly recommend them to anyone looking for comfortable, well-fitting sheets at a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
J
Verified Purchase
John cromwell
Draper, US
★★★★★ 5
Finally we BOTH can sleep comfy!
Color: 08 - Black, Size: Queen
So for years my boyfriend has always liked “jersey sheets” or “tee shirt” sheets or sheets made of flannel. He says he doesn’t like the feeling of cold “silky” feeling sheets as he’s always cold. I’m opposite and am always hot, and anytime we stayed in a nice hotel I looked forward to being able to sleep on cooler, taught, soft sheets for a couple of nights. I was able to deal with our old sheets but the issue we both hated was after awhile any sheet we got would get pilling. We even splurged and got a $60 flannel sheet which did the same thing forcing me to shave off these little annoying fuzz balls that make it feels like there is thousands of crumbs on the sheets. I also would wash our bedding once a week because the Jersey sheets seemed to “grow” as we move around in bed making it so the sheet was not taught and super annoying to lay on. The day I would wash them they would be comfortable but ultimately by the end of the week they would be almost hanging off our mattress. I ordered these sheets on a whim and got them the same day and immediately just threw out the jersey sheet and put this on (I didn’t even wash it, I know it’s gross but I was desperate for a comfy nights sleep and they came around 8pm) when I put them on I realized how soft and comfortable they felt. I also liked how the pillow cases are larger than most pillow cases that I have had in the past. We’ve been using these sheets for about a week and I love how I don’t wake up with my pillow popping out of the case anymore. The sheets have loosed ever so slightly since a week of sleeping but still are really taught and comfortable. They are cooler than flannel or fabric sheets and are initially cold when you first lay on them but I wouldn’t consider them “cooling” but they keep me from feeing extremely hot. They are way better than I ever would have expected for the price. I look forward to laying on them at the end of each day, even my boyfriend laid in bed the day I got them and said “wow I didn’t think I would like sheets like this, these are so soft!” And fell asleep immediately. We ended up ordering a second set in grey and the color is pretty. I still have yet to wash them, I usually use 2 tide pods when washing the bedding but I might get some fabric softener (as I hear it helps with pilling) to prevent the possibility of having that happen to these sheets in the future. I am hoping they hold up well after the wash and longer use. If they start to pill after wash, I will come back and update my review. Until then, I would highly recommend these sheets for the quality and the price point that they are offered at. Honestly, at this point even if they pill months from now I probably wouldn’t even be upset as long as they stay the same price I would just buy another set as they are just that comfortable and soft. UPDATE: So it has been about 3 months since I have purchase and used these sheets. They are still as soft as the day I first put them on. I’ve been washing them bi-weekly along with my comforter and pillowcases. I wash them with warm water using a combination of tide pods and added Downy fabric softener. They say to hang dry them in the description but I have been putting them in the dryer on medium and have been taking them out after around 20-25 minutes, they seem to dry extremely quickly. They have yet to have absolutely any pilling and also have not shrunk or stretched. Also I have a cat that is very active and also sleeps with me who enjoys kneading on my bed and I haven’t even noticed any signs of wear what so ever to the eye or to the feel. I highly recommend these sheets. I still have yet to even open the second set I purchased!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2024
L
Verified Purchase
Lp
Grantham, US
★★★★★ 5
Amazing quality for the price! So fresh and lightweight
Color: 03 - Light Grey, Size: Queen
I am very impressed with this queen sheet set! I originally bought it because of the great price, but the quality has exceeded my expectations. The fabric is incredibly soft, lightweight, and stays very fresh throughout the night. It truly gives you that comfortable hotel bedding feel without breaking the bank. If you are looking for breathable and budget-friendly sheets, I highly recommend this set
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products