SKU: 51327664609

Human CD90, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD90, hFc tagProduct Specification Species Human Synonyms CDw90, Thy 1 antigen Accession P04216 Amino Acid Sequence Protein sequence(P04216, Gln20 Cys130, with C hFc)

Product Specification


Species Human
Synonyms CDw90, Thy-1 antigen
Accession P04216
Amino Acid Sequence

Protein sequence(P04216, Gln20-Cys130, with C-hFc) QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:38.6 kDa Actual:54 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Thy-1 or CD90 (Cluster of Differentiation 90) is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of Thy-1 led to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to some of the initial biochemical description and characterization of a vertebrate GPI anchor and also the first demonstration of tissue specific differential glycosylation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51327664609

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
csboyd
Charlottesville, US
★★★★★ 5
A must have for active dogs
Size: Max Size, Size: Max Size
I normally do not write reviews unless a product is really good or really bad. I have a dog that thinks chasing balls is the only thing in life and unfortunately she has a mom that has anchor pins in both shoulders. We've been using this ball launcher for little over a year. It goes through about 32 dirty balls, 3 times a day and has held up amazingly. It is even full of dirt and still keeps on working, it looks like R2D2 went thru a battle. 😆 I recently bought a second one as a back up because I can't believe this poor thing hasn't given up yet. I rotate the balls because my dog brings them back wet and muddy, then they won't launch as far, so I knock some dirt off of a dry one and launch it. I would highly recommend this for active dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
T
Verified Purchase
Terry
Natrona Heights, US
★★★★★ 5
Damaged...
Size: Max Size
Very well made product. But it does not work. I am so bummed. Would like to return and get another one shipped out to me. It is a Xmas gift for our dog. Thank you...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
J
Verified Purchase
Jennifer Shrout
Pawtucket, US
★★★★★ 1
DO NOT BUY! IT BREAKS EASILY.
Size: Max Size
DON’T WASTE YOUR MONEY! The first time I bought this product it broke within a couple of weeks. The conveyor belt stopped spinning making the unit unusable. The second one I bought broke within the first hour. Again the conveyor belt but this time it would spin uncontrollably even when the unit was turned off. We used the balls included in the packaging and with supervision which is recommended in the product pamphlet. I tried to reach out to All For Paws but was unable to locate a working customer service number. For the price it should continue to work without issue. Very disappointing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
J
Verified Purchase
JEB
Birmingham, US
★★★★★ 4
Your dog Might Not Be as Excited as You Are
Size: Max Size
It arrived and worked as expected. Throws a good distance, not loud & easy to use. However, my rescue Belgian Shepherd (24/7 ball dog) was totally scared of it. Work with her for a week but she would literally avoid even being in the same room. Being she is rescue you never know what happen to them in the past. Moral of the story, just bc you have a full-on ball dog doesn’t mean they will be excited as you are. Unfortunately had to return.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
D
Verified Purchase
Darlyn Ponce
Boise, US
★★★★★ 3
Good but not great.
Size: Max Size-EPTU Balls
Good but not great. We had to return. We liked it first out of box BUT as soon as the balls got damp from grass and slobber they were not launching well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025

recommand products