SKU: 53612600367

Human Urokinase Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Urokinase Protein, His tagProduct Specification Species Human Synonyms Urokinase type plasminogen activator, U plasminogen activator, uPA, PLAU Accession P00749 Amino Acid Sequence Protein sequence (P00749, Ser21 Leu431, with C His tag)

Product Specification


Species Human
Synonyms Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU
Accession P00749
Amino Acid Sequence

Protein sequence (P00749, Ser21-Leu431, with C-His tag) SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Expression System HEK293
Molecular Weight Predicted MW: 48.1 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Urokinase - type plasminogen activator is a serine protease that plays a crucial role in the fibrinolytic system. It is mainly produced and secreted by various cells, such as endothelial cells and monocytes. u - PA specifically converts plasminogen into plasmin, which is capable of degrading fibrin clots and extracellular matrix proteins. This process is essential for maintaining the balance of blood coagulation and fibrinolysis, as well as for tissue remodeling and wound healing. Dysregulation of u - PA has been implicated in many pathological conditions, including thrombosis, cancer metastasis, and inflammatory diseases. Therefore, u - PA is an important target for the development of drugs to treat these diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53612600367

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
The Product Connoisseur
Draper, US
★★★★★ 3
Classy pair that look great but don’t last
Size: 12, Color: Black, Size: 12, Color: Black
Great shoe. Slip on is easy and the shoes are comfortable and classy. Ten months later and the bottom has holes and didn’t last.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025
J
Verified Purchase
Jon
Natrona Heights, US
★★★★★ 5
Love it
Size: 11, Color: Black
Almost the perfect travel shoe. Goes well with both casual and formal attire. Walked like a million steps with this in Japan, SEA, etc. only thing it probably can't do is probably hiking. Otherwise the leather feels really high quality, and the shoe slips on without much fuss. I'd describe the style as: a dressed-up Converse
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
J
Verified Purchase
jack brice
Massapequa, US
★★★★★ 1
Would not every buy marc Joseph shoes ever
Size: 11 Wide, Color: Black
The marc Joseph shoes did not hold up had a blow out rightside of shoes had the shoes for about two weeks when my wife noticed and say that not good.i buy Cohen shoes and Clarke shoes
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
J
Verified Purchase
Jon F
Port Orchard, US
★★★★★ 2
Great shoe, horrible lace design.
Size: 13, Color: White, Size: 13, Color: White
This shoes look great and the materials for the actual shoe feel great. They run a little big that doesn't bother me. Unfortunately, the lace design is horrible. I've now have 2 pairs of these shoes and both times the bottom lace has ripped out of the stitching. The first time was on the 2nd day I wore them, and the replacement pair to those it happened after I walked 20 feet. Both times I've tied a knot in the bottom lace so that I could get through the day. Ideally these laces should be connected together and not attached to the shoe (this is how both of my Skechers Slip-ins are designed). Because I like the rest of the shoe so much I'm buying elastic laces to replace the horrible original laces.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
S
Verified Purchase
suzanne kagan
Waukegan, US
★★★★★ 5
Wonderful
Color: Blue Flake Tortoise, Size: Small
Beautiful glasses. I get many compliments
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025

recommand products