SKU: 53846806400

Human CD8, hFc tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8, hFc tagProduct Specification Species Human Synonyms T lymphocyte differentiation antigen T8 Leu 2, MAL Accession P01732 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C hFc)

Product Specification


Species Human
Synonyms T-lymphocyte differentiation antigen T8/Leu-2, MAL
Accession P01732
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-hFc) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

Predicted MW: 43.7 kDa Observed MW: 55 kDa

Purity >95% by SDS-PAGE
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). Along with the TCR, the CD8 co-receptor plays a role in T cell signaling and aiding with cytotoxic T cell-antigen interactions. Like the TCR, CD8 binds to a major histocompatibility complex (MHC) molecule, but is specific for the MHC class I protein. There are two isoforms of the protein, alpha and beta. The extracellular IgV-like domain of CD8-α interacts with the α3 portion of the Class I MHC molecule. Cytotoxic T cells with CD8 surface protein are called CD8+ T cells. Once the T cell receptor binds its specific antigen Lck phosphorylates the cytoplasmic CD3 and ζ-chains of the TCR complex which initiates a cascade of phosphorylation eventually leading to activation of transcription factors like NFAT, NF-κB, and AP-1 which affect the expression of certain genes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53846806400

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Natalia Arlashina
Omaha, US
★★★★★ 5
beautiful and high-quality jewelry box
Amazing jewelry box of good quality. color - exactly as in the photo (mine is olive). High-quality interior decoration. Everything as in the seller's photo. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2025
K
Verified Purchase
Katie Roberts
Birmingham, US
★★★★★ 5
Functional gift.
Used as an engraving project with our laser printer. Worked well, would make a great gift for bridesmaids etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2025
L
Verified Purchase
lyric
New York, US
★★★★★ 5
So cutie
Color: Cloud White, Material Type: Paper, PU
This is a bit large for a travel size jewelry box lol I really thought it was going to be a bit smaller than what it was. I can see why some of the ladies in the comments are saying they’re using it as their main jewelry box since they don’t have much jewelry for a standard sized jewelry box. With that being said, it’s cute and CAN be small enough for travel. It fits a lot and I got this one in particular bc I like that it has a bigger lower compartment for larger pieces. It’s a nice quality travel jewelry box. It’ll fit my needs. But if you have a knack for packing small and you value space. I’d say skip on this one or do due diligence to double check the measurements to see if it’s something you’re okay with packing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
D
Verified Purchase
Deena M
Pawtucket, US
★★★★★ 5
Good value
Color: Jelly Pink, Material Type: Paper, PU
This is a great jewelry box for travel or to just keep at home. Very stylish and holds more than it looks like it would.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026
C
Verified Purchase
Chavely
San Leandro, US
★★★★★ 5
CUTE
Color: Cloud White, Material Type: Paper, PU
I absolutely love this jewelry organizer! The 2-layer design gives it plenty of space without being bulky, making it perfect for travel. I was able to neatly store my earrings, necklaces, rings, and bracelets without anything getting tangled. The interior is soft and protects my jewelry really well, and the compartments are thoughtfully designed to keep everything in place. The compact size fits easily in my suitcase or handbag, which is a huge plus. The cloud white color looks elegant and makes it feel like a great gift option too. Overall, it’s practical, stylish, and very convenient for keeping jewelry organized on the go. Highly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026

recommand products