SKU: 54071054747

Human IL-6,His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6,His tagProduct Specification Species Human Synonyms B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2),IFNB2 Accession P05231 Amino Acid Sequence Protein sequence(P05231, Val30 Met212, with C 10*His)

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:22.4kDa Actual:20-23kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54071054747

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Heidi G
Bozeman, US
★★★★★ 5
Almost as good a chewing on my belt.
Size: 25 Inch
My corgi has always loved chasing her leash or a belt so I thought the snake would be a good fit for her. It quickly became her favorite. The squeakers lasted for maybe a month? Once there was a hole then we took them all out so she wouldn't choke. The snake without the squeakers is still a favorite. She's been chewing the tail end consistently and likes to lick it for some reason. I recommend this as a good tug toy. I like that it was made of leather.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
N
Verified Purchase
ncgirl
Houston, US
★★★★★ 3
DISAPPOINTED
Size: 25 Inch, Size: 25 Inch
I've bought this 9 times since it's my Maltipoos' favorite toy! Unfortunately the one that just came in is not up to par as those previously bought. The leather was cut sloppily & the sewing sometimes ran off the leather completely or so close to edges could easily be chewed open. I can't send back because bought as a treat before leaving for trip & the fact he's already seen it ! I used sewing machine to sew areas that were close to edges - had to take out stitches to remove top squeaker to be able to sew around that area on both sides. Don't know how long this one will last even though I used quilting thread which is a bit stronger than regular thread. Hope this was just a bad one & if so, wish company's quality control would have caught this & rejected it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
K
Verified Purchase
KJ
Grantham, US
★★★★★ 4
Not for aggressive chewers
Size: 36 Inch
My GSD ate half of it within 20min before I caught her. I don’t think it was meant for aggressive chewers so I can’t fault the product for that. My dogs did have a few hours of fun with it playing tug and it held up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
E
Verified Purchase
EWE
Alexandria, US
★★★★★ 5
Doug (my daughter’s dog) absolutely LOVES THIS TOY!
Size: 15 Inch
My daughters dog, Doug , loves this toy….. I have bought 3 of these in the past 12 months! Though he will destroy it, he chews and plays with it until there is almost nothing left!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
L
Verified Purchase
L. Crotty
West Palm Beach, US
★★★★★ 5
Emotional Support Lizard
Size: 15 Inch
This was my Goldendoodle puppy's first toy, and a year later, it's still his favorite. It was light enough for him to play with it at 9 pounds, but big enough that he still loves it at 40 pounds. He carries it around, slaps his brother with it, throws it and chases it, sleeps with it, etc. He enjoys his stuffies also, but he returns to this one repeatedly through the day, so I know he loves it. It's a bit discolored, but still fully intact. If you have a dog with a soft mouth who isn't prone to chewing, this toy is perfect. I've purchased extras to keep in the emergency supplies in both the house and the car.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026

recommand products