SKU: 54364280694

Rhesus macaque IFNA13 Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 4 - Sep 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque IFNA13 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Interferon, alpha 13 Accession A0A5F8AJA6 Amino Acid Sequence Protein sequence (A0A5F8AJA6, Cys25 Leu182, with C His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL Expression System HEK293 Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Rhesus macaque
Synonyms Interferon, alpha 13
Accession A0A5F8AJA6
Amino Acid Sequence

Protein sequence (A0A5F8AJA6, Cys25-Leu182, with C-His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL

Expression System HEK293
Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFNA13, or Interferon Alpha-13, is a member of the type I interferon (IFN) family, a group of cytokines crucial for innate immunity against viral infections. It signals through the shared IFNAR1/IFNAR2 receptor complex to activate the JAK-STAT pathway. This leads to the expression of interferon-stimulated genes (ISGs) that establish an antiviral state in cells. IFNA13 is implicated in the early immune response. Research suggests its expression and potential roles may vary in different pathological contexts, including viral diseases and certain cancers, warranting further investigation into its unique biological activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54364280694

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Melisa F
Whiting, US
★★★★★ 3
Good quality, but hard
Color: Brown
The leather and metal seem to be of very good quality. My son bought this as his office/study chair. He is starting medical school and liked the professional look of this chair. He is 6’ tall and 200lb. There does not seem to be an issue with the chair rolling even with his weight. The chair is very ‘hard’ not that comfortable if you need to sit in it for long periods. Since my son needs to be staying awake to study, this will work for him as he won’t be able to get too comfortable and fall asleep.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
S
Verified Purchase
Saeed Rabbanifar
Boise, US
★★★★★ 5
Easy assembly and smooth movement
This chair has been a great addition to my home office. The assembly instructions are simple and easy to follow. The height adjusts smoothly, and the chair is very comfortable. I sit at my desk for about 9 hours a day, and this chair makes it easy to stay seated and work for long hours without discomfort. The cushioning and back support are solid. It spins well, and the wheels move smoothly. The build quality feels sturdy and reliable. Overall, a great value and a solid choice for anyone with a desk job. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
J
Verified Purchase
Jim N.
Los Angeles, US
★★★★★ 5
Great chair
Color: Brown
Love this chair. Very comfortable and supportive. Color matches my leather couch perfectly. Time consuming to put together.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
L
Verified Purchase
Langle
Birmingham, US
★★★★★ 5
Beautiful and very steady office chair
Color: Brown, Color: Brown
Beautiful, Ergonomic, and very steady for this good quality leather office chair. The side armrests and the back support are very comfortable to seat. The assembly instruction and illustrated photos are quite simple to follow which make ease of assembly. I got the brown color leather which matches perfectly with my desk. Overall , I am very please with this office chair
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
S
Verified Purchase
Santiago
Chelsea, US
★★★★★ 5
Excellent materials
Number of Items: 2
Incredible craft with this chair. For the price point it could definitely be over double the current price. Comfortable, easy to assemble and excellent materials.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026

recommand products