SKU: 54585152699

LILRB4/CD85k/ILT3 Fc Chimera Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB4/CD85k/ILT3 Fc Chimera Protein, MouseProduct Specification Species Mouse Accession Q64281 1 Amino Acid Sequence Gly24 Lys238, with C terminal Human IgG Fc

Product Specification


Species Mouse
Accession Q64281-1
Amino Acid Sequence Gly24-Lys238, with C-terminal Human IgG Fc GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 65-80kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4) is a member of leukocyte Ig-like receptors (LILRs). LILRB4 is encoded in the leukocyte receptor cluster, which is on human chromosome 19q13.4. The structure and function of LILRs are similar to those of other leukocyte receptor cluster receptors, such as killer cell immunoglobulin-like receptors. Leukocyte immunoglobulin-like receptor (LILRB4) is a kind of inhibitory receptor that plays a key role in immune checkpoint pathways. Inhibitory receptors also participate in achieving balance between activating and inhibitory actions to ensure immune responses to pathogens in the immune system. However, they not only protect the host from autoimmune responses, but also preserve peripheral tolerance. LILRB4 also regulates immune responses, and its role in regulating immune responses is mostly controlled by its ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54585152699

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Maggie The Red
Port Orchard, US
★★★★★ 5
Great quality, perfect
Model: 2 Pack Salt and Pepper Grinder, Model: 2 Pack Salt and Pepper Grinder
I wanted a refillable salt and pepper grinder for my dining table and these are perfect! These are glass, fine grind, superb quality and great price. Love it and I think you will too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
P
Verified Purchase
Phala Alfaro
Waukegan, US
★★★★★ 5
Love it
Model: 2 Pack Salt and Pepper Grinder, Model: 2 Pack Salt and Pepper Grinder
So far I’m loving it, it’s working great for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
J
Verified Purchase
JJ
West Palm Beach, US
★★★★★ 5
Great table ware.
Size: 1.7" x 5.1", Size: 1.7" x 5.1"
They are great to leave on the center piece of your table, nice quality, they look nice and work great. Easy to adjust the size of ingredient that you might need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
C
Verified Purchase
Cheryl
Waukegan, US
★★★★★ 5
Perfect Compact Size and Smooth Efficient Grind
I absolutely love these salt and pepper grinders! They are perfectly-sized, less cumbersome than most 12"+ sized grinders. They're wide enough to hold more than it looks like they hold, which means less refilling required. The grind is smooth and flawless - it usually only takes me one quick single-hand- motion to season my plate. I use pink Himalayan salt, and black peppercorns, and can adjust it easily to suit my or my husband's grind preferences. These grinders are pretty enough to set out on a table for dinner guests, while being quick and efficient for ourselves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2025
R
Verified Purchase
RCC
Fort Morgan, US
★★★★★ 5
Perfect Salt & Pepper Grinders
Size: 2.5" x 5.1"
Excellent design, size and function, plus they have CLEAR PLASTIC TOPS so you can easily see how much ground salt or pepper you have to sprinkle on your food. After using my first set I knew I needed another set for different combinations of pepper corns in particular. Oh, and they come with an extra set of ceramic grinding wheels (yes, ceramic, not plastic as a few reviewers falsely claim). Very smooth operation and adjustable from fine to coarse sizes. Here's my recommendation for use. First, use quality coarse salt and whole pepper corns. Second, don't grind with lid off over hot steaming food while cooking because the steam will negatively effects the salt and pepper in the grinders, the grind quality you get, and will ultimately clog the grinders. Just grind with lid on until you get the required amount (hence the need for the clear caps), open the caps and sprinkle. Easy peasy... ☺
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2023

recommand products