Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 27 - Sep 1
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA6/CD85b/ILT8 His Tag Protein, HumanProduct Specification Species Human Accession Q6PI73 1 Amino Acid Sequence Gly24 Asn447, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | Q6PI73-1 |
| Amino Acid Sequence | Gly24-Asn447, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-7 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
LILRA6, Leukocyte Immunoglobulin-like Receptor subfamily A, member 6, also called CD85b and ILT8.The leukocyte immunoglobulin-like receptor (LILR) multigene family is a family of paired receptors composed of inhibitory and activating forms, which are highly homologous in their extracellular regions and different in their intracellular regions. LILRA6 is the activating forms, which have two or four Ig-like domains with short cytoplasmic tail and associate with FcRγ chain containing immunoreceptor tyrosine-based activation motifs. LILRA6 (ILT8/CD85b) and LILRB3 (ILT5/CD85a) are paired receptors expressed by myelomonocytic leukocytes. LILRA6 and LILRB3 have high similarity in their extracellular domain, making them further difficult to distinguish., and mAbs generated against these receptors bind to neutrophils. In addition, LILRA6 is correlated with susceptibility to atopic dermatitis. LILRA6 on the surface of macrophages induces and regulates cytokines such as IL-4, IL-10, IL-17, TNFα and IFN-γ.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.0 ★★★★★
Based on 12 reviews
Sort
Product Reviews
★★★★★ 5
A good value for the money.
Number of Items: 1
Chair was very easy to assemble. It is a lightweight chair but not cheap. I find it comfortable and the controls work well. Extra bolts are provided which is a great feature. I find the adjustable back support excellent, the head rest moves a little to easily, but it is easy to adjust while sitting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
★★★★★ 4
Overall good chair for a good price
Number of Items: 1
Comfortable chair, but there's a very slight lean. I haven't yet managed to track down what's causing it, but as I slowly spin around, I find myself tilting slightly forward, then left, then back, then right... I've removed the casters and then removed/reinstalled the "ring" of legs, so the next place to check is the connection between the post and seat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
★★★★★ 5
well made for price
Number of Items: 1
well made and comfortable chair
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
★★★★★ 5
The best office chair!!!
Number of Items: 1
The chair is great quality, sturdy, and was easy to put together. Looks just like the photos and video. It is SUPER comfortable - the most comfortable chair ever! If you’re looking to purchase an office chair/ desk chair - this is the one! The price was reasonable and I would 100% recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
★★★★★ 5
Great chair, only one issue.
Number of Items: 1
As someone who is exactly 6ft tall, this chair is just about perfect for my height and body type. High quality materials, adjustable lumbar support, very ergonomic. Visually, it works well with my desk setup. It has already helped me improve my posture ten-fold.
My only complaint might be that the tension on the recline joint is too much. Twisting it to the loosest setting doesn’t feel loose enough, you’ll need to put your feet up on something to recline comfortably and stay in that position. Other than that, great chair. I don’t see myself returning this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026