SKU: 5500243286

CNTF Protein, Human

Sale price$172.80 Regular price$192.00
Save 10%

Pay in installments of $48.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CNTF Protein, HumanProduct Specification Species Human Synonyms CNTF Accession P26441 1 Amino Acid Sequence Ala2 Met200, with N terminal 6*His MHHHHHHDDDDKAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM Expression System E. coli Molecular Weight 26 28 kDa(Reducing) Purity 97% by SDS PAGE & RP HPLC Endotoxin <1EU g

Product Specification


Species Human
Synonyms CNTF
Accession P26441-1
Amino Acid Sequence

Ala2-Met200, with N-terminal 6*His MHHHHHHDDDDKAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Expression System E.coli
Molecular Weight 26-28 kDa(Reducing)
Purity

>97% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH7.5
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Ciliary neurotrophic factor (CNTF) is a member of the interleukin-6 family of cytokines. CNTF is a differentiating cytokine that drives cells toward a predominantly astrocytic fate. In HD, CNTF is the most widely studied neurotrophic factor. CNTF is the first and currently the only trophic factor to enter clinical trails in HD. CNTF has trophic effects on striatal neurons as seen in both in vitro and in vivo studies. Some of the earliest studies administered CNTF to the brain by direct infusion of the protein using pumps. An infusion cannula was implanted directly into the striatum and recombinant CNTF was continuously infused using an osmotic pump. This method of CNTF administration was efficient at significantly reducing cell death within the QA-lesioned striatum. A major pitfall of this method of administration is the need to constantly infuse CNTF into striatum. Additionally, large amounts of CNTF may be needed at one time to establish adequate diffusion throughout the striatum.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5500243286

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brandi
Cuba, US
★★★★★ 5
So good!
Format: Kindle
Oh my goodness! What did I just read? Lyra Winters you have some serious explaining to do! That cliffhanger killed me! I am so happy to be back in the world of Kalista. This is definitely darker than Fates Hollow but oh so good. This is a fated mates reverse harem which I absolutely love. Pandora had a very hard and rough upbringing. She lives in pain constantly and it makes it hard on her. She struggles with everything because she was kept so isolated and is new to her magic. Pandora gets sent to the Reform Academy and all of them have reasons why they are there. I love how, after everything she has been through, she is still a nice person. She is growing and becoming stronger too. Love her character. The guys all act like jerks at first but all have a back story that helps understand why even though want to smack them. I'm here for the groveling that I'm sure will come. I love them all. They each bring something for her. They are all drawn to her though. This is a slow burn book but there will be more books in the series so sure it will build. Man, that cliffhanger was a doozy and need book 2 now!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2024
C
Verified Purchase
Courtenay
Grantham, US
★★★★★ 3
Good-ish
Format: Kindle
🌶️ 0/5 ⭐️ 3/5 I will preface this by saying I am not a huge RH fan. However it didn’t feel like a RH quite yet. The relationships and plot are all building in this book. At first I was thinking things were happening stupid fast since she’s had zero interaction with another being and has been tortured her whole life, and I believe they were for one side of the relationship, but by 50% things moved too slow lol. Idk I think the main 1-3 guys I’m actually interested in more than the others didn’t get enough air time so I hope the next book things start moving with them since it ended the way it did.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2025
F
Verified Purchase
Florina3090
Chelsea, US
★★★★★ 5
Can I have Term 2 now?
Format: Kindle
This is by far my favorite book of Lyra's to date. I gobbled this book up so fast, I was so upset I finished it. I know this is going to be a book I reread, just like Fate Hollow Academy. I loved Fate Hollow Academy, so I was excited when Lyra announced she was taking us readers back to Kalista. Although the characters from Fate Hollow are mentioned several times throughout the book, this book is about Pandora and her love interests in the Demon Realm. Before you deep dive into this book, definitely look at the trigger warnings before you start. When Lyra says there's dark themes in this book, she meant it. Also, just know this book does end on a cliffhanger and will probably leave you with as many questions as it did me. Below may contain some minor spoilers, so keep that in mind if you want to keep reading my review. Pandora's first 2 decades of her life are full of torture, hatred, and confinement in a cellar. That is until her father finds her and brings her into the world she was supposed to live in. Because of her upbringing she wasn't acclimated to the Demon world and the way their society works so when she is offered the chance to go to a Demon Reform Accademy, she accepts it to learn the ways of society and how she is supposed to feed. Pandora isn't like the other common demons in this world, no. She, like her father Death, are soul-eaters. Pandora is too scared to release her powers because she doesn't want to kill anyone, so she needs to learn how to feed off of a piece of soul instead of taking the whole thing. Because of who her father is, she's classed as a Noble, and while she doesn't agree with her fellow Noble students, who look down on the "lower" class, she also is faced with 3 Demons who hate her for being a Noble. Theses a lot of back and forth tension which these 3 demons who have issues of their own. One is obsessed with her, and wants to know all of her secrets. One leaks fear all over the place, but also is scared of the "princess" -wink- -wink-. One is a complete drunk who doesn't like her just because he's got family Noble problems. Don't worry, there are 2 other demons who are just the sweetest towards her. One who will get vengeance for anything done to her, he's got Golden Retriever energy around her and touch her and die energy for anyone around her. Finally, there is one who is friends with her even when the whole school is scared of her, who brings her into his dreams and will create nightmares for those who bother her.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2024
M
Verified Purchase
Mystery_Machine_Gang
Dallas, US
★★★★★ 4
This was more than I expected...
Format: Kindle
So...I finished this book at nearly 2am! It was just that hard to put down. I loved that it's set in the same world as Fates Hollow but in the future. Poor Pandora has been through so much but there's light at the end of the tunnel for her. She finally meets her dad and it turns out he's amazing. In order to help her learn about demon society and how to control her magic he sends her to the Demon Reform Academy. There she meets 2 awesome demons who help her and care for her. She also sadly meets her 3 tormentors. I will say though that while they do bully Pandora they also rescue her several times and defend her. They too have traumatizing pasts and can't see the good that is in front of them. Of course demon society needs to be shaken up too since that's part of the problem. I really enjoyed this read. I teared up a few times throughout the book but I liked the characters and that ending...well it looks like 3 in denial are going to need to grovel hard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2024
K
Verified Purchase
Krystle
Pawtucket, US
★★★★★ 5
MUST READ BOOK!!
Format: Kindle
I was in a huge reading slump, when one of my favorite authors recommended this book in her readers group (The amazing Marie Mistry 🫶) and I absolutely DEVOURED this book. Now I’m in the club crying about having to wait until December for Term 2! This book is about a girl named Pandora who has suffered a life that nobody would ever wish to have. This book is about Pandora learning how to live, learning about herself and what she really wants. She has a long journey to find out all of these things, but she took the first steps in this book and it was beautiful to read. Some of the men in this book are our dream men, Hunter and Reed 😍 and then we have the men who need some work and who we all really just want to beat up until they admit what they really feel, Skel, Bram and Dexter. But that cliffy was a killer and I absolutely cannot wait until the next book!! You have written an absolute dream of a book Lyra and I eagerly await the next installment in this series!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2024

recommand products