Pay in installments of $85.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 28 - Sep 2
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA3 His Tag Protein, HumanProduct Specification Species Human Synonyms Leukocyte immunoglobulin like receptor subfamily A member 3 Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | Leukocyte immunoglobulin-like receptor subfamily A member 3 |
| Accession | Q8N6C8 |
| Amino Acid Sequence | Gly24-Glu439, with C-terminal 8*His GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 68-75kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 22 reviews
Sort
Product Reviews
★★★★★ 5
Great watch
Color: Black
Looks great easy to use and used these watches for years
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
★★★★★ 5
New Look, Same Timex
Color: Black, Color: Black
Long time wearer of Timex Ironman watches and the T200 is among the best. Stylish, comfortable and dependable. This watch is exactly as described and I know it will make a reliable time piece for years to come.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
★★★★★ 5
Love Time
Color: Pink, Color: Pink
I love this watch 😍 I usually get the smaller gray/black one. Though this one is A LOT bigger than I expected. Not remembering the size of my wrist, plus the old saying is ... Why do women have a hard time telling distance ? Because we were told this 🤏was six inches long 🤣. The color wasn't quite how I thought it would be either, so that through me off a bit. I love the colors & I have been wearing Timex Iron Man watches for 37 yrs. I will not wear anything else. They'll last for years. Once the battery dies, I just get a new one. I also wear mine almost 24/7. I discovered these when I was 18 & needed a good watch for work (food service) whitch take a lot of beating. What's the old saying ? Time takes a licking and keeps on ticking. It's so true!!! I did try a couple before my Timex Iron Man, yeah, Nope. Timex is the best !!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
★★★★★ 4
Reliable watch, bad shipping
Color: Pink
I have had a couple other Timex watches. My 1st lasted many years before it quit working. This watch is my 3rd. My 2nd Timex still works but was smaller than I prefer so I bought this one. I'd have given this one 5 stars if it had arrived on time and not had made my subscription order arrive late as well because my items ship to arrive on a set day. My auto ship happened to be when I ordered this watch. I was given a tracking # for USPS at first, to arrive on October 27. Then got notification it would arrive the 28th, THEN got an email saying November 2nd and coming by UPS. It arrived 4 days after it was supposed to. The watch is good, but the shipping was not.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025
★★★★★ 5
Good watch
Color: Black
Needed a practical watch for everyday use and this fit the bill. Not too big, has a good sized watch face.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025
recommand products
OneUp Components EDC Plug & Pliers Kit
31.00
OneUp Components Chain Guide V2
47.00
ODI Elite Pro Lock-On Grips
23.00
RockShox MegNeg Air Can Upgrade Kit for Deluxe and Super Deluxe Rear Shocks
69.00
HellermannTyton SNP1GHS0M4 Snapper Hose Clamp, .24"–.26" Bundle Diameter, PA66GF13, Black, 1000/pkg
199.88