Pay in installments of $60.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 27 - Sep 1
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
C1qR1/CD93 His Tag Protein, HumanProduct Specification Species Human Synonyms C1q MBL SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix remodeling associated protein 4 Accession Q9NPY3 Amino Acid Sequence Thr22 Lys580, with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | C1q/MBL/SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4 |
| Accession | Q9NPY3 |
| Amino Acid Sequence | Thr22-Lys580, with C-terminal 8*His TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 88-95kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Greenlee-Wacker M C. et al. (2011) Membrane-Associated CD93 Regulates Leukocyte Migration and C1q-Hemolytic Activity during Murine Peritonitis. J. Immunol. 187: 3353-3361. 2、Nepomuceno R R. et al. (1997) cDNA cloning and primary structure analysis of C1qRp, the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro. Immunity. 6: 119-129. 3、Nepomuceno R R. et al. (1998) C1qRp, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets. J. Immunol. 160: 1929-1935. |
Background
Complement component 1q (C1q) receptor 1 (C1qR1, also known as C1qRp, or cluster of differentiation 93-CD93) is a 126-kDa type 1 transmembrane glycoprotein expressed in endothelial and hematopoietic cells, and responsible for C1q-induced phagocytosis. CD93 contains one C-type lectin domain and five EGF-like domains. Mature human CD93 consists of a 557 amino acid (aa) extracellular domain (ECD) with one C‑type lectin domain, four tandem EGF‑like domains, and a mucin‑like domain, followed by a 21 aa transmembrane segment and a 51 aa cytoplasmic domain. CD93 is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Soluble CD93 promotes the differentiation of monocytes to macrophages, phagocytosis of apoptotic cells, and inflammatory responsiveness to multiple TLR ligands.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 10 reviews
Sort
Product Reviews
★★★★★ 4
Overpriced but effective.
Color: Cream
I happened to get lucky and get a warehouse deal at an additional 30% discount. Even at $25, it feels a little overpriced. But it was easy to assemble and serves its purpose. If you line the Velcro up exactly, the panels sag, if you stretch past even, but where it still grips, they look pretty ok. It is very light and does fold very compact for easy storage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
★★★★★ 5
Great price for a great product
Color: Coal Black
Excellent quality and great price to boot. Easy to assemble and folds up easily to be stored. We are using it as a privacy screen when we have company that needs to sleep on the couch and also to block off a hallway leading to a guest suite. It looks great and is as described in the ad
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
★★★★★ 1
No.
Color: Coal Black, Color: Coal Black
This was horribly made and a nightmare to put together. You have to basically bend the bars to get the coverings attached. The sizes don't match. The stickers that label the parts are impossible to remove and if you do get them off theres a lot of residue left behind. On top of that once it was put together I noticed theres a big dirty foot print on it which is definitely not mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
★★★★★ 3
You have to add weight to it
Color: Coal Black
It does its job and it was easy to put together but it's a little on the flimsy side and it will easily be knocked down. So you're going to have to figure out a way to make the legs heavier? I used cinder blocks, single cinder blocks and it works just fine. Just know that it will knock over super easy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
★★★★★ 5
The snap to put them together.
Color: Coal Black
This came in handy in the foyer. I didn’t want to see the door from my couch. I must be weak found it hard to snap them together. I kept 2 my daughter took the other 2.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
recommand products
Dell N3224PX-ON 24x 10GB PoE Copper 4x 25GB SFP28 2x 100GB QSFP28 F-B Air Switch
1552.49
Brocade NI-CES-2024C-AC CES 2024F 24x 1GB RJ45 4x 1GB Combo Switch
261.00
HPE AJ834A 1m LC to LC Multi-Mode OM3 Fiber Optic Cable
600.50
Cisco N3K-C3636C-R 36x 100GB QSFP28 Front-to-Back Airflow Switch
1664.99
NEW Fortinet FS-148E-POE 48x (24x PoE+) RJ45 4x SFP - Local Manage Only Switch
213.00