SKU: 58239173435

CEACAM-6/CD66c His Tag Protein, Cynomolgus

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-6/CD66c His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM6, CD66c, CEAL, NCA Accession XP_014979566. 2 Amino Acid Sequence Gln35 Gly320, with C terminal 8*His

Product Specification


Species Cynomolgus
Synonyms CEACAM6, CD66c, CEAL, NCA
Accession XP_014979566.2
Amino Acid Sequence Gln35-Gly320, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLPQNTLGFNWYKGERVDAKRLIVAYVIETQQTTPGPAHSGRETVYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNDQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANLSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Duxbury M S. et al. (2004) Overexpression of CEACAM6 promotes insulin-like growth factor I-induced pancreatic adenocarcinoma cellular invasiveness. Oncogene. 23(34): 5834-5842.

2、Lewis-Wambi J S. et al. (2008) Overexpression of CEACAM6 promotes migration and invasion of oestrogen-deprived breast cancer cells. Eur J Cancer. 44(12): 1770-1779.

Background

Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of seven human CEACAM family members within the immunoglobulin superfamily. Human CEACAM-6 is a 90 kDa, GPI-linked membrane protein that contains a 34 amino acid (aa) signal sequence, a 286 aa extracellular domain (ECD), and a 24 aa hydrophobic C-terminal propeptide. CEACAM-6 contains one N-terminal V-type Ig-like domain (N domain), followed by two C2-type Ig-like domains. It shows considerable glycosylation, including (sialyl) LewisX, which mediates binding to E-selectin, galectins and some bacterial fimbrae. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 58239173435

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
CJ
Lake Worth, US
★★★★★ 5
Excellent buy
Color: Black
Great buy. We put it on our bed and it's Great. No more having cords streaced across the room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
M
Verified Purchase
Marilyn
Lexington, US
★★★★★ 5
Great Power Strip
Color: White
Works great for our guest bedroom.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026
T
Verified Purchase
trc
West Palm Beach, US
★★★★★ 3
Nice but a bit awkward
Color: White
Kind of awkward to use but provides more outlets. I put it under my computer shelf so it doesn’t look bulky & it works fine. It can slip around from time to time when plugging in things but I’m living with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 16, 2024
S
shannon oakley
West Palm Beach, US
★★★★★ 5
Great room divider
Color: Black, Size: 4 Panel-88'', Color: Black, Size: 4 Panel-88''
This is a room divider and would work great as one! I’m using it as a cover for my car port/garage so you can’t look in and see my messy garage as easily and for what I’m using it for it’s a little not quite as sturdy as I need it to but I’m sure it’s not meant to be used outside anyways so I don’t fault the product since I’m not using it as intended… with that said though…. It still covers my garage beautifully and really does exactly what a I need it to! I’m sure the wind may blow it over if it gets too crazy but I don’t see it breaking by any means. The frame is metal and drilled together using long screws. It’s very well built. The cloth for the panels is this waterproof type material that’s kind of like the gazebo roof feeling. So it’s easy to clean and it’s easy to wipe. You can put it straight or bend the panels and either way it still stands up. You don’t HAVE to bend it to make it stand or anything. You can literally use it straight across like I am in the pictures. Overall very happy with this product and it’s also very tall so it truly covers a lot (hides a lot lol). I’m 5’8 so you can see it’s taller than me by the pic I took
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
F
3fingers
Louisville, US
★★★★★ 3
OK. Drag to setup. Needs more stable feet
Color: Black, Size: 4 Panel-88''
I was glad to find these. The benefits of having them in a recording setup is helping suppressing noise for a vocal booth. It's a layer that surrounds the recording box. Nice! (But away from audio hardware or DAW). Here is the not so nice part: The feet! It's able to stand (as it needs to do this). But it cannot be bumped. If it does, it's coming down onto something. I believe the feet units are not wide enough (or long enough). That makes for an easier tumble risk. So far, they haven't, but it's like being in the woods over leaves - it feels dangerous with every step! (That's actually true). They are tall enough, wide enough, material OK. But the feet for the main assembly do not seem sturdy enough. There are ways to help that. I'm thinking a 2x4 to augment the base. Make them wider. It can be done. It was a drag to set these up, and I'm sure to modify them like i'd want them. But, they do come in at a much lower price that other similar dividers. Consider all this because I've seen more solid dividers ( with padding) that would basically be the 1/2 cost of these. But i'd think they'd be easier to assemble, stand sturdier, and without that feeling of an impending fall (or fail). This is my opinion. I hope it helps.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products