SKU: 58624763982

Human CELSR3 Protein, His tag

Sale price$297.00 Regular price$330.00
Save 10%

Pay in installments of $82.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CELSR3 Protein, His tagProduct Specification Species Human Synonyms Cadherin EGF LAG seven pass G type receptor 3, Cadherin family member 11, Epidermal growth factor like protein 1 (EGF like protein 1), Flamingo homolog 1 (hFmi1), Multiple epidermal growth factor like domains protein 2 (Multiple EGF like domains protein 2), CDHF11, EGFL1, FMI1, KIAA0812, MEGF2 Accession Q9NYQ7 Amino Acid Sequence Protein sequence (Q9NYQ7, Arg71 His180, with C His tag)

Product Specification


Species Human
Synonyms Cadherin EGF LAG seven-pass G-type receptor 3, Cadherin family member 11, Epidermal growth factor-like protein 1 (EGF-like protein 1), Flamingo homolog 1 (hFmi1), Multiple epidermal growth factor-like domains protein 2 (Multiple EGF-like domains protein 2), CDHF11, EGFL1, FMI1, KIAA0812, MEGF2
Accession Q9NYQ7
Amino Acid Sequence

Protein sequence (Q9NYQ7, Arg71-His180, with C-His tag) REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH

Expression System HEK293
Molecular Weight Predicted MW: 13.3 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cadherin EGF LAG seven-pass G-type receptor 3 is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 58624763982

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Kasley.K
Chelsea, US
★★★★★ 4
Sweet second-chance romance
Format: Kindle
When You Smile was my introduction to Melissa Brayden’s writing, and Dream a Little Dream confirmed that this author creates lovely stories with amazing characters. This book was a sweet second-chance romance with enough sad moments to make me shed some tears. It also has a surprise reveal that I didn’t see coming and a small-town community that made me feel warm and cozy. I loved Kyle and Savanna. Their first meeting nearly got me giggling, but I was definitely kicking my feet and smiling like a fool. Savanna was endearing and had a knack for public announcements. I felt deeply for her and truly understood her reaction after getting hurt. As for Kyle… is there a word to describe her? I could feel her aura bleed through my screen. Her flirting and ability to get through Savanna’s defense left me swooning one or two times. I honestly don’t know how Savanna managed to stand on business so 10 out of 10 for her effort. I really enjoyed Dream a Little Dream and can’t wait to read another Melissa Brayden’s book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2025
P
Verified Purchase
Patricia L Estes
Bozeman, US
★★★★★ 5
Wonderful
Format: Paperback
This was a hard book to put down. The characters of Svanna & Kyle are so well developed, as our their families and friends, who just enhance the whole story. When Savanna is left on the bridge, my heart broke, was amended later, and fulfilled by the end of the book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
G
Gary L. Jones
Houston, US
★★★★★ 5
Dream…
Format: Kindle
I loved this book right from the get-go. The snappy repartee between Savanna and Kyle made me laugh and shiver with delight all through this book. Toss in all the great characters in Dreamers Bay and I was sold! Wonderful story, great plot twists, fantastic highs and lows. A true smorgasbord of emotions. Thanks Melissa…
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
A
Verified Purchase
Angela
New York, US
★★★★★ 5
Loved this book so much
Format: Kindle
First, it’s a cute story with a great themes of: younger older woman, daughter‘s friend, disgruntled with family. I have to admit every time the main character was talking to her father I was so incredibly annoyed. It brought up all the conversations I’ve ever had with misogynist in my life. Definitely well written. On happier notes; the love story, the meddling neighbor/landlord, cute child, and kittens! Really, what story isn’t made better by kittens? Seriously this is an exceptionally well written story with fantastic characters, plot lines, and a great ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
R
Verified Purchase
R S Jordan
Whiting, US
★★★★★ 4
A Thoughtful and Compelling Romance with Depth and Maturity
Format: Kindle
Miranda MacLeod and TB Markinson deliver a compelling and emotionally charged romance in The Anatomy of Forever, a novel that successfully balances personal transformation, ethical dilemmas, and the weight of professional responsibility. Dr. Rowan Colchester, newly embracing her true self after a difficult divorce, is not prepared for the whirlwind that follows a passionate encounter with a younger woman. When fate reunites her with Dr. Simone Doucette, an idealistic doctor seeking solace in a Cape Cod ER, their undeniable connection becomes fraught with complications. The revelation of their unexpected personal link adds a layer of tension that challenges not only their burgeoning relationship but also their careers and reputations. As the stakes rise, Rowan and Simone must navigate professional ethics, small-town scrutiny, and their own vulnerabilities to fight for a second chance at love. While the “sleeping with your daughter’s best friend” trope initially presents a hurdle, the novel compensates with a well-developed plot that offers depth beyond the romance. MacLeod and Markinson craft a narrative rich with stakes that extend beyond the personal, grounding the story in a high-stakes professional and community-driven context. The characters are well-drawn and compelling, both Rowan and Simone stand out as confident, determined, and capable women who refuse to be defined by societal expectations or past mistakes. Even secondary characters, such as Erica, evolve in ways that add nuance to the story. A refreshing aspect of The Anatomy of Forever is its portrayal of strong, independent women who communicate effectively and fight for what they want. Rather than relying on contrived misunderstandings or overplayed angst, the novel explores mature relationship dynamics, making the romance feel authentic and rewarding. Overall, this is a well-executed sapphic romance that offers substance, well-rounded characters, and a satisfying blend of personal and professional stakes. MacLeod and Markinson have crafted a narrative that is engaging, thought-provoking, and ultimately, deeply satisfying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2025

recommand products