Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 3 - Sep 8
For Your Every Summer RSVP, with Code: SUMMER15
Description
Apolipoprotein A-I/APOA1 His Tag Protein, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His
Product Specification
| Species | Human |
| Synonyms | Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1 |
| Accession | P02647 |
| Amino Acid Sequence | Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ. |
| Expression System | E.coli |
| Molecular Weight | 29.6 kDa |
| Purity | >98% by SDS-PAGE and RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris-HCl, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy