SKU: 60669802586

Rat Alpha-1-acid Glycoprotein Protein, His tag

Sale price$209.25 Regular price$232.50
Save 10%

Pay in installments of $58.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Alpha-1-acid Glycoprotein Protein, His tagProduct Specification Species Rat Synonyms Orosomucoid (OMD), Orm1 Accession P02764 Amino Acid Sequence Protein sequence (P02764, Gln19 Pro205, with C His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP Expression System HEK293 Molecular Weight Predicted MW: 23. 3 kDa Observed MW: 23 43 kDa Purity 95% by SDS

Product Specification


Species Rat
Synonyms Orosomucoid (OMD), Orm1
Accession P02764
Amino Acid Sequence

Protein sequence (P02764, Gln19-Pro205, with C-His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Expression System HEK293
Molecular Weight Predicted MW: 23.3 kDa Observed MW: 23-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alpha-1-acid glycoprotein, also known as orosomucoid, is a major acute-phase protein synthesized primarily in the liver. As a glycoprotein with high carbohydrate content, it exhibits increased plasma levels during inflammation, infection, or tissue injury, reflecting its role in immune modulation and host defense. Structurally, AGP binds to various ligands, including drugs, lipids, and cytokines, influencing drug pharmacokinetics and immune cell interactions. It is involved in regulating inflammation, modulating lymphocyte function, and potentially contributing to tumor progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60669802586

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Greg
New York, US
★★★★★ 5
Good product
Size: 49ft, Number of Items: 6
Works as advertised!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
J
Verified Purchase
Jennifer W.
Chelsea, US
★★★★★ 3
Depends on your needs
Size: 49ft, Number of Items: 6
Good value for amount paid. It is NOT easy to tear, what so ever; you will need scissors for a clean edge. The 10mm size is not the best width for tshirt transfers, as it is difficult to pickup after pressing; however, it does well at holding the transfer in place.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
N
Verified Purchase
Nancy Lewis
New York, US
★★★★★ 5
Heat resistant tape
Size: 49ft, Number of Items: 6
Just started in making things a friend suggested these tape
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
T
Verified Purchase
Tay
Waukegan, US
★★★★★ 5
A great printer with lower pricing
Style: ET-4800, Color: White, Set: FAX/ADF/Print/Copy/Scan
I am quite happy with my ET-4800 purchase. From wirelessly connecting to my Mac to software installation to adding the ink, it was easy to set up. I feel you can't go wrong with this level of ink capacity. It holds so much ink without the bother and added expense of frequently replacing cartridges. I will never go back to a cartridge machine. I don't care who makes it! I've used my printer several times so far, and each time it has done a great job by giving me the colors and clarity that I expected. This is the first printer that I've owned that wasn't a front-feeder. I wasn't sure how I would like that, but I've found that holding the paper straight and then dropping it into the slot rather than placing it, gives the best result for paper alignment. For my needs, I have only used it one sheet of paper at a time. So if you are wanting to load several sheets at once, your loading experience may be different from mine. But just make sure that you do not load more than 100 sheets at a time, per the manufacturer's instructions. Also, be sure that the movable paper guides are in the correct spots for the size of paper being used, without any buckling. To date, I have not used the scanner, but it is definitely a feature that I did not want to be without, so I'm looking forward to using it. The display window, though small, is simple to follow along with, and I appreciate that the angle of the keypad can be adjusted. Working with the Epson Smart Panel app gives a bit more flexibility, particularly if you're not right next to your printer and want to check the ink levels or start a printing job. To use the app, be sure that you turn on your printer first and that both the printer and your device are set to the same wi-fi, so that the app can find your printer and you can begin operating it from afar. Once inside of the app, be sure to check out the "Other Features Menu" from the app's homescreen. There is a link to another Epson app that can be used to boost your creativity and streamline layouts for collages, and a colorful guide full of project ideas that outline everything that you need for each project and how to execute them. There's even a feature for sharing what you've scanned and submitting it as an assignment. This is something that you'd want to read more about to see if it is an applicable and helpful addition for you. You can use the search term, "google classroom in epson smart panel app," to find out more. There is only one downside that I have found at this point. The pull-out paper catching tray in the front feels flimsy. It seems out of place on an otherwise sturdy machine. But so far, I've had no problems with it. I just take my time pulling it out, flipping down the end, folding it back up, and pushing the tray back in. I figure if I baby it a bit, then all should be well. Overall, I really like the Epson ET-4800 as much as my ET-5170. I feel it performs well at an acceptable price point.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Excellent product for the price.
Style: ET-4800, Color: White, Set: FAX/ADF/Print/Copy/Scan
I have had many, many printers over the many years at the business and for home. I honestly think this is the best value for what I need. The eco tank is fabulous. This is the first printer I have purchased with the ecotank. So much better than the cartridges. The quality is good and it was easy to setup and put on the network. I did wait a few months before writing this review to truly test it out and write a fair review. I am pleased. I have had Epson products in the past and do appreciate their quality and affordability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products