SKU: 61707768916

Human CD43 Protein, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD43 Protein, His TagProduct Specification Species Human Synonyms Leukosialin, GPL115, Galactoglycoprotein (GALGP), Leukocyte sialoglycoprotein, Sialophorin, SPN Accession P16150 Amino Acid Sequence Protein sequence (P16150, Ser20 Arg253, with C His Tag)

Product Specification


Species Human
Synonyms Leukosialin, GPL115, Galactoglycoprotein (GALGP), Leukocyte sialoglycoprotein, Sialophorin, SPN
Accession P16150
Amino Acid Sequence

Protein sequence (P16150, Ser20-Arg253, with C-His Tag) STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Expression System HEK293
Molecular Weight Predicted MW: 25.1 kDa Observed MW: 40-120 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukosialin also known as sialophorin or CD43 (cluster of differentiation 43) is a transmembrane cell surface protein. Sialophorin (leukosialin) is a major sialoglycoprotein on the surface of human T lymphocytes, monocytes, granulocytes, and some B lymphocytes, which appears to be important for immune function and may be part of a physiologic ligand-receptor complex involved in T-cell activation. Defects in the CD43 molecule are associated with the development of Wiskott–Aldrich syndrome. It also appears in about 25% of intestinal MALTomas. Using immunohistochemistry, CD43 can be demonstrated in the paracortical T-cells of healthy lymph nodes and tonsils; it is also positive in a range of lymphoid and myeloid tumours. Because it stains granulocytes and their precursors, it is an effective marker for myeloid tumours.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61707768916

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tabbitha Beard
Massapequa, US
★★★★★ 1
Doesn't work period. I bought these based off of videos. All these products suck
No none of these products worked for me
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Amazon Prime
Belleville, US
★★★★★ 5
Beef Tallow Sunscreen Stick (Kid-Friendly)
Our family absolutely loves this beef tallow sunscreen stick! It’s become a must-have for park days, sports, vacations, and everyday outdoor activities. The stick format makes application quick and easy, especially when applying sunscreen to active kids who don’t like standing still. The formula glides on smoothly and feels moisturizing without being greasy. I love that it’s made with simple, skin-friendly ingredients and mineral sun protection, making it gentle enough for sensitive skin. My kids haven’t experienced any irritation, and it helps keep their skin soft and protected even during long days outside. One of the biggest benefits is how convenient it is to reapply. The stick fits easily in a backpack, diaper bag, or purse, and there’s no messy lotion to spill. It works great on faces, noses, ears, and shoulders, which are often the areas most exposed to the sun. Why We Love It: - Kid-friendly and easy to apply - Gentle on sensitive skin - Moisturizing with nourishing beef tallow - Convenient, mess-free stick format - Great for outdoor adventures and travel - Mineral-based sun protection Overall, this sunscreen stick provides reliable protection while keeping skin moisturized and comfortable. It’s a fantastic option for families looking for a simple, natural, and kid-friendly sunscreen that makes sun protection easy for everyone. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
Y
Verified Purchase
Yae.Lynn
Louisville, US
★★★★★ 5
Obsessed with this sunscreen stick!
Just got this Beef Tallow Sunscreen Stick and I'm honestly really impressed! I wasn't sure what to expect since I've never used a tallow based sunscreen before, but it feels so nice on my skin. It glides on super smoothly, doesn't leave a weird sticky feeling, and makes my skin feel moisturized instead of dry like some sunscreens do. I also love how easy it is to throw in my bag and just reapply throughout my day. The ingredients are a huge plus for me too ofc! I like that it's made with beef tallow, honey, and beeswax instead of a bunch of stuff I can't pronounce. I've worn it outside for a few hours already and it held up great. No irritation, no white cast, and my skin felt really soft afterward. Definitely happy with this purchase and I'll be keeping it in my daily routine. Highly recommend if you're looking for a more natural sunscreen option!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
A
Verified Purchase
Alianet Fernandez
Carnegie, US
★★★★★ 5
Loved This Sunscreen Stick ☀️
I really love this sunscreen stick! It feels smooth on the skin, doesn’t leave a heavy white cast, and the natural ingredients make it feel very gentle. I also liked how moisturizing and easy to apply it was. Perfect for everyday use and great for keeping my skin protected outdoors! ☀️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
J
Verified Purchase
Jalynn
Cuba, US
★★★★★ 4
Good but very small
The texture is smooth and it smells nice. Definitely way smaller than I was expecting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026

recommand products