SKU: 62437891574

Rabbit IgG lambda, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rabbit IgG lambda, his tagProduct Specification Species Rabbit Amino Acid Sequence Protein sequence (with C 10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 0 kDa Observed MW: 17. 0 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered solution of 0. 2M PBS,

Product Specification


Species Rabbit
Amino Acid Sequence

Protein sequence (with C-10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.0 kDa Observed MW: 17.0 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Lambda light chains are one of the two classes of light chains present on mammalian immunoglobulins. They are found in combination with kappa light chains. These chains are usually present in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62437891574

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Melissa Routheaux
Grantham, US
★★★★★ 3
Poop bag and treat dispenser questionable
Color: 9 Pack (No-stuffed Fox)
This is a hard one. The toys seem great. The whole box smells of the poop bags and I don't think they should be a part of the purchase. The bigger issue i see is the treat ball seems to have a weird plastic coating on it. Almost like a thin clear coat that gives is a peeling feeling and I don't think it is safe for the puppy. Excited to see how she likes the other toys though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
T
Verified Purchase
Tollie
Fort Morgan, US
★★★★★ 5
Great durable toys for baby/small dogs
Color: 9 Pack (No-stuffed Fox)
These were perfect for our 8 week old dachshund. She loves every one of the toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
N
Verified Purchase
NanMax
Dallas, US
★★★★★ 5
Great Variety for Teething Puppies, Keeps Him Busy!
Color: 9 Pack (No-stuffed Fox), Color: 9 Pack (No-stuffed Fox)
I got this 9-pack toy set for my 11 lb chihuahua-terrier mix puppy, and it’s been very well received by my little guy. He’s been bored being in quarantine until his vaccines kick in and he's also teething. This toy set has made a huge difference. Great variety - you get a combination of rope toys, plush squeaky toys, and even a treat ball, so he often rotates between them depending on what he wants. The rope toys have been especially good for teething, while the softer toys keep him entertained. One of the plush toys has that crinkly texture inside, which he loves. The treat ball is a nice bonus too. I've put treats and his dog kibble in there throughout the day, and it helps keep him engaged and also mentally tires him out. Everything is sized well for a small puppy and light enough for him to carry around easily. The materials feel decent for the price, especially considering how many toys you get. That said, I do keep an eye on him with the softer ones since he’s still a puppy and likes to chew. Pros: Good mix of rope, plush, and interactive toys Great for teething and keeping him occupied Treat ball adds a mental challenge Good size for small dogs/puppies Nice value for the number of toys Cons: Softer toys may wear down faster with heavier chewing Overall, this has been a really useful set during a phase where he’s both teething and needs a lot of mental stimulation. I’d recommend it for small dogs or puppies, especially if you want a variety instead of buying individual toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
Anay Cuba Castellanos
Fort Morgan, US
★★★★★ 5
Perfect Puppy Starter Toy Set
Color: 9 Pack (No-stuffed Fox), Color: 9 Pack (No-stuffed Fox)
This toy pack is such a great value for puppies. My puppy stayed entertained for hours and loved having different textures to chew and play with. The toys feel soft but still durable enough for everyday use. A few of the smaller toys are better for light chewing, but overall it’s a fun variety pack for keeping a puppy happy and active.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Good for tiny puppies
Color: 9 Pack (No-stuffed Fox)
Very nice for small breed puppies! To small for average size puppies but still works! The price right!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products