SKU: 62723608213

B7-H5/VISTA His Tag Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

B7-H5/VISTA His Tag Protein, MouseProduct Specification Species Mouse Accession Q9D659 Amino Acid Sequence Phe33 Ala191, with C terminal 8*His FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Mouse
Accession Q9D659
Amino Acid Sequence Phe33-Ala191, with C-terminal 8*His FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 33-43 kDa(Reducing)
Purity

>95%  by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

B7-H5, also known as VISTA, is one of the negative immune checkpoints of the B7 family. B7-H5 which is the most conserved among the B7 membersis mainly expressed in myeloid cells such as macrophages, monocytes, dendritic cells, and T cellsVISTA is a type I transmembrane protein consisting of a single N-terminal immunoglobulin (Ig) V domain, an approximately 30 amino acid (aa) stalk, a transmembrane domain, and a 95 aa cytoplasmic tail. It can regulate a variety of immune cells, including B cells, T cells, and endothelial cells by binding to its putative receptor(s) on these cells.The expression of B7-H5 is closely related to the diagnosis, severity and prognosis of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62723608213

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Excelente 5 meses ya con el arranque y esta excelente lo recomiendo
Carnegie, US
★★★★★ 5
excellent watch
Color: Black Band Black Face
excellent watch
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2025
C
Verified Purchase
Cornelius
Los Angeles, US
★★★★★ 1
Don't buy this brand Olev. Watches last for one month, return window is one month.
Color: Gold and Silver Band White Face, Color: Gold and Silver Band White Face
I want a refund!!! A little over a month of owning this product and it's broken. Really cheap craftsmanship and the return window is only for one month. Please don't buy from this brand Olev. I would assume they know that they're product isn't any good if the return window is only one month.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2025
D
Verified Purchase
Dwi
Lake Worth, US
★★★★★ 5
Great !!! Awsome
Color: Gold and Silver Band Blue Face
The watch is beautiful, if you get the watch you will get alot of attention. Very good quality 10/10
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2025
H
Verified Purchase
Huntington Wilkinson
Phoenix, US
★★★★★ 5
Good quality
Color: Gold Band Gold Face
Not a bad quality. The size of the watch did not reflect as per pohotograph
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2025
J
Verified Purchase
James David Reyome
Massapequa, US
★★★★★ 5
Almost the perfect watch
Color: Black/Blue
I have owned three earlier models of these things going back to the days when I actually ran road races. They are brilliant pieces of work. My only complaint of them was that the start/stop/split button(s)--there were two on the older models--were too small. Well, apparently Timex listens and the two small buttons are now combined into one larger one. Probably this was done years ago but I'm only now getting back into road work, so now I get to discover it. The perfect watch? Almost. I especially like this model as my eyes are not what they used to be and the oversized face makes it easier to read. The downside to this is that it also makes the crystal easier to scratch. That's always been an issue, but I can live with it. No, the real problem with this product is, was, and apparently ever shall be, the band. Now, it could be worse, it could be a resin band (like the old ones) that will crack and break within a couple of years, but no, this is a nylon and velcro wrap style which should be just dandy, but for three glitches: 1. it's too short 2. it's too narrow (gee whiz, Timex designers, it's an oversized watch, why not a matching oversized band?) and 3. it's still resin where it attaches to the actual watch. Now, I imagine it's probably less prone to breakage in how it's implemented, but if you should choose to replace it, I can see no obvious way of removing it short of cutting it off. Really? But these are minor complaints. I doubt it would be comfortable on anyone whose wrists are much bigger than my own, but replacement bands are everywhere, and this watch will keep time with style and it's brilliant at splits. Heck, it even functions admirably as a backup for my expensive stopwatches at our regular short track stock car events. For my money (and did I mention the price is wonderful?) the Ironman is still the best at what it does, and for what it can do.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2014

recommand products