SKU: 64447018498

Human CBP, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CBP, His tagProduct Specification Species Human Synonyms CREB binding protein, Histone lysine acetyltransferase CREBBP, Protein lysine acetyltransferase CREBBP, CREBBP, CBP Accession Q92793 Amino Acid Sequence Protein sequence (Q92793, Thr144 Ser417, with C 10*His)

Product Specification


Species Human
Synonyms CREB-binding protein, Histone lysine acetyltransferase CREBBP, Protein-lysine acetyltransferase CREBBP, CREBBP, CBP
Accession Q92793
Amino Acid Sequence

Protein sequence (Q92793, Thr144-Ser417, with C-10*His) TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.9 kDa Observed MW: 43-90 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CREB-binding protein, also known as CREBBP or CBP or KAT3A, is a coactivator encoded by the CREBBP gene in humans. CBP has intrinsic acetyltransferase functions; it is able to add acetyl groups to both transcription factors as well as histone lysines, the latter of which has been shown to alter chromatin structure making genes more accessible for transcription. CBP alone has been implicated in a wide variety of pathophysiologies including colorectal cancer as well as head and neck squamous cell carcinoma. In these diseases, association of CBP with β-catenin has been shown to promote cancer cell proliferation and disease aggressiveness, whereas p300/ β-catenin leads to cell differentiation and/ or apoptosis. CBP has also been shown to help modulate liver function via maintenance of energy homeostasis in response to changes in cell nutrition conditions by regulating the activity of transcription factors and genes responsible for lipogenesis and gluconeogenesis. CBP is also implicated in the etiologies of several other diseases including hematologic malignancies and other solid tumors, diabetes, schizophrenia, Alzheimer's disease, depression, and many other neurological conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64447018498

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mary
Massapequa, US
★★★★★ 5
A great sunscreen I have used for years!
Size: 1.7 Fl Oz (Pack of 1)
This is a product I have used with great success over the years and keep coming back to. Neutrogena is just a brand I really have trusted since my teenaged years of using their glycerin soap. This product does not disappoint. It dries down clear and moisturizes your face in preparation for makeup. I really appreciate that it plays well layering all my products and makeup like some sunscreens do. I also love the higher SPF of the product. I feel like the higher the better when it comes to the damaging sun. There is one thing I do not care for, and that is the smell. It has a strong smell at first when put on, but luckily quickly becomes unnoticeable, otherwise, I wouldn’t buy it. If I had to pick one sunscreen for my face forever, this would be it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
SLC83
Belleville, US
★★★★★ 4
Wears well under makeup!
Size: 1.7 Fl Oz (Pack of 1)
Package arrived on time. No damages and product was in great condition. Pro: Goes on smoothly. Nice coverage. No white cast. Is fragrance free--no weird smell. Washes off easily with a cleansing oil or balm. Great on my sensitive skin! Wears well under my makeup, and it sat well over my vitamin c serum, too. This sunscreen layers with other face moisturizer really well! Con: I can't wear it around eyes; it causes stingy/ burning eyes. But, I have sensitive eyes ( sunscreens or mascara).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 5, 2026
K
Verified Purchase
Kim Conard
Alexandria, US
★★★★★ 5
Great product
Size: 1.7 Fl Oz (Pack of 1)
Nice product. I like the pump to get a small amount. Glides nicely on my skin and no white residue. Not sticky.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
C
Verified Purchase
chelsea
Waukegan, US
★★★★★ 5
* Horrible eye pain! * Made my face glow! Great for dry skin as a moisturizer spf
Size: 1.7 Fl Oz (Pack of 1), Size: 1.7 Fl Oz (Pack of 1)
Update* After actually wearing it all day reaction - I wore this in the semi-sun to the beach just to walk to shoreline, not actually sitting in sun or getting into water just a 30 minute walk, and by one hour in my eye started to swell and both eyes were in horrible pain. I had to go was my face and eyes as well as put in repeated cosine to help my eyes. My eyes even over night after thorough washing and cleaning still have a slight pain to them. This also clogged some pores and made me itch and break out. I think if you are going to be in AC and no hint of sun or sweat this would be okay. However if you are buying to walk around in any kind of sun this may not be it. For me personally I will be returning. I was hoping this would’ve worked for me. I love neutrogena products but the reaction to my eyes impossible to use for me. First initial opening and putting in my face reaction- Very light weight. Smaller size than I realized. Makes my skin have a sheen soft glow. I would highly recommend for those who have dry skin. If you have naturally oily skin this may have a little too much sheen in it for you all. It does make my face feel absolutely baby soft. I was looking for a moisturizing spf for my face that doesn’t turn my skin white or cake on and over my skin and this is great. I will try it in the sun today and see how it lasts and works. No white at all which I absolutely love. Feels great in my skin. Fragrance free has barely any smell to it which is also nice. Oxybenzone free. It is slowly drying into my skin which is nice. I do not believe it is water or sweat proof so you will have to reapply. It hasn’t hurt my eyes so far but I will update when I am out in the sun to share more feedback if this feedback isn’t the same. Overall very happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2024
R
Verified Purchase
rsorrell
West Palm Beach, US
★★★★★ 5
Excellent purchase
Size: 1.7 Fl Oz (Pack of 1)
It seems like it's a small bottle, but it works really well and goes on smooth. It helps me look healthy and I'm 65 years old.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026

recommand products