SKU: 65654209826

CD7 Ligand/SECTM1 Fc Chimera Protein, Human

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession Q8WVN6 Amino Acid Sequence Gln29 Gly145, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal Human IgG1 Fc QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 44-49kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65654209826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Rebecca Maney
Chelsea, US
★★★★★ 4
Lovely!
Format: Hardcover
What a lovely, lyrical, hopeful book! Children will love the many possibilities that it will bring to expand on its inspiring creativity!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2023
K
Verified Purchase
Kindle Customer
San Leandro, US
★★★★★ 5
Another awesome amazing wonderful Christian book
Format: Kindle
This is a very strong wonderful book. I am able to learn more about how to build and strengthen my relationship with God and Jesus. I also learned that Jesus has 50 Commandments and I was able to look this up. I am planning to write them down and follow The 50 Commandments of Jesus. I also learned more about the Witness, The Church Communities, The 144,000 Faithful, and how satan will try to destroy God children(us) and God planes. But we all know God win's. Matthew Robert Payne starts by telling us he is trying to give us a visual of how the end times may go. Everything Matthew Robert Payne talks about is in the bible and Matthew is giving us an example of how the end times could look like. I truly recommended this book. I recommend Matthew Robert Payne books because his books truly help you build your relationship with God Jesus, the Holy Spirit, the ArchAngel's, the Angel's, and the Saint's. I was not a person who likes to read Christian books. But when I became ready to build a relationship with God Jesus, the Holy Spirit, the ArchAngel's, the Angel's, and the Saint's plus I was lead by the Holy Spirit to wonderful authors like Matthew Robert Payne. I became a devoted follower of God Jesus and a person who loves to read Christian books in fact I read nothing but Christian books and enjoying my journey towards God and Jesus. I truly believe Matthew Robert Payne is a wonderful loving caring gentleman who only wants to help his brother's and sister's in Christ to be fulfilled in Christ, and walk like Jesus. So my recommendation is read this book and other wonderful loving caring Matthew Robert Payne books. I'm living proof that Matter Robert Payne books will change your life in a beautiful loving caring way and you will find yourself feeling God Jesus, the Holy Spirit, the Saint's, the ArchAngel's and the Angel's present's in your life. I'm a blessed Christian, wife, mother, family member, Child of God, and sister in Christ. God truly has his hands in Matthew Robert Payne life because he is a awesome amazing wonderful and truthful Christian Gentleman. God Bless
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2016
A
Verified Purchase
Andrea
Lexington, US
★★★★★ 5
Exciting and insightful revelation presented in an easy-to-read way.
Format: Kindle
Matthew Robert Payne shares his personal revelations, visions, and thoughts on the end times church, the two witnesses, the 144,000 and more with a spirit of integrity and humility. I really enjoyed reading about what God had revealed to him about the two witnesses, it was radical stuff, that was not even slightly on my radar, on in my personal understanding and was exciting and interesting to read. If you want to be a part of the end times church, this part of the book is essential reading. You'll gain insight into what will happen, what you need to do to be safe and how to be used as one of God's end-time harvesters. Learn about Matthew's interpretation of who is the 144,000.This book is a must-read. It will inspire you to start living set apart for Jesus right now where you are. Read the book now!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2018
T
Verified Purchase
The minor prophet, ed
Charlottesville, US
★★★★★ 4
An optimistic view of the endtimes
Format: Kindle
I like Matthew's writing style.For a subject as esoteric like Revelation, he makes it an easy read. I would have given it 5 stars if this was an audio but for some repetitious statements. He brings to light the pivotal role of the two witnesses and the 144,000 in end-time harvest. It gives you an optimistic view of the future in keeping with the theme of the New Testament. A real blessing to the Bride waiting for the Groom. Maranatha!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2017
K
Verified Purchase
Kathy van Wilgenburg
Charlottesville, US
★★★★★ 5
End times made (more) simple.
Format: Kindle
Matthew has taken a difficult topic and expanded on it based not only on the Word, but also based on visions, prophecy from others, and revelation knowledge from the Holy Spirit. He gives new ideas and strengthens old ones. For instance, I have always thought the two witnesses in Revelation are Enoch and Elijah because God took them (they did not die) and because man is appointed once to die. This was reinforced by this book, and I believe that it is a leading by the Holy Spirit within the critical framework of the Word. Its a short read and worth your time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2016

recommand products