SKU: 6628397135

Human CD40, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD40, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 5, B cell surface antigen CD40, Bp50, CDw40, CD40L receptor Accession P25942 Amino Acid Sequence Protein sequence (P25942, Glu21 Arg193, with C 10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CDw40, CD40L receptor
Accession P25942
Amino Acid Sequence

Protein sequence (P25942, Glu21-Arg193, with C-10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.1 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD40 is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of CD40 and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with CD40 and serves as a mediator of the signal transduction. The interaction of CD40 and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Moreover, CD40 molecule is a potential target for cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6628397135

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
dc-in-md
West Palm Beach, US
★★★★★ 4
Nice shirt. Wrinkles alot.
Size: 4X-Large Big, Color: Light Grey Vertical Stripe
Like the style and construction of the shirt. Fit and finish are as expected. Unfortunately the fabric wrinkles easily. Definitely requires ironing. Wish this shirt was a wash and wear but it's definitely a wash and iron before wearing shirt. Otherwise I have no complaints. Fabric is lightweight and could be used in summer as a dress shirt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2024
M
Verified Purchase
MJM
Waukegan, US
★★★★★ 5
good value
Size: 4X-Large Big Tall, Color: Pale Pink
These are amazing for the price. They are good quality shirt and the material is thicker than I expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
M
Verified Purchase
muzixplorer
Bozeman, US
★★★★★ 5
Very nice shirts
Size: Large, Color: White
These are a heavier fabric than I was expecting but that’s fine since it’s winter. They barely shrink being washed in hot water and dried in a hot dryer. I was actually hoping that they would shrink a little more after losing 40 pounds. But they shrunk just a little and they fit just fine. Also, if you take them out of the dryer immediately there are very few wrinkles.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
A
Verified Purchase
Ashley Cloyd
Pawtucket, US
★★★★★ 3
Dress shirt
Size: XX-Large Big Tall, Color: Powder Blue
The material is a nice quality and the color is very close to the picture but I think it’s a bit darker in person. It definitely doesn’t fit like a “tall” should though but I think if we would have sized up it would have been to big. Overall it was an ok purchase for what we needed it for but it is a bit short.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
P
Verified Purchase
Pat Jensen
Cuba, US
★★★★★ 5
Fit check = great
Size: X-Large, Color: Light Grey Vertical Stripe
Happy to finally find a great shirt fit for both business and casual looks. This shirt line is made in Sri Lanka (not Bangladesh). It has a great fit around the shoulders and chest for a 40 year old American male. It fits true to form and was recommended to me directly by Grok AI based on my exact waist, chest and neck measurements. It doesn't pull tight across the chest, and fits really nice with a sport coat. It's comfortable and breathable, the fabric is thick and high quality. You can wear this tucked or untucked depending on the attire you need. I bought 2 and will definitely buy the rest of the color line up. I'd love to see more colors and patterns available in this fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2025

recommand products