SKU: 68567939187

EPHA7 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHA7 ProteinProduct Specification Species Human Accession Q15375 1 Amino Acid Sequence E595 V998(end)

Product Specification


Species Human
Accession Q15375-1
Amino Acid Sequence

E595-V998(end)

ELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20mM Reduced Glu, 0.05% Brij-35, 10% glycerol, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68567939187

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Literally doesn’t work
New York, US
★★★★★ 5
Great Value Toy
Color: Crinkle Duck (Blue), Size: Large, Color: Crinkle Duck (Blue), Size: Large
This toy has been one of my dog’s absolute favorites. He gets excited every time he sees it and will carry it around the house, toss it in the air, and keep himself entertained for a long time. The shape and texture seem perfect for him, and it quickly became one of his go-to toys over everything else in his basket. What I really like is that it holds up reasonably well for the price. It’s definitely not indestructible, and after a lot of play, it will sometimes start to rip—usually around the feet first since that’s where my dog tends to grab and chew the most. But honestly, considering how affordable it is, I don’t mind replacing it when needed. It’s inexpensive enough that rebuying feels worth it because he genuinely loves it that much. I’d rather keep buying a toy he is obsessed with than spend more on something that just sits untouched. It’s fun, cute, and keeps him happy, which is what matters most. Overall, I’d definitely recommend it for dogs who love plush toys and playful chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
L
Verified Purchase
Lady B
Louisville, US
★★★★★ 5
Best affordable squeaker toy
Color: Crinkle Chicken (Brown), Size: Large, Color: Crinkle Chicken (Brown), Size: Large
my dog is obsessed with this toy, this has became his new comfort toy and after having this for about four months the legs are falling off but it’s very durable. The squeaker also moved from the head of the chicken to the body of the chicken but that’s after it was played with every single day. I love that it has two squeakers and it’s the perfect toy for my dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
S
Verified Purchase
Sara Salazar
Alexandria, US
★★★★★ 5
Beautiful design, perfect quality for seasoned destroyers.
Color: Crinkle Duck (Yellow), Size: Large
Absolutely adorable, excellent quality, I have a couple of monsters whose teeth make any kong toy tremble, I was very concerned whether something as soft and nice would last. So far so good. Good looking and soft and tough at the same time!.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
M
Verified Purchase
MADDY
Massapequa, US
★★★★★ 5
Best fun indestructible toy
Color: Crinkle Duck (Yellow), Size: Large
Truly indestructible no matter how much our oittie tries. She has owned it for three months works at destroying every day with no success. She carries it everywhere. Best purchase for chewer, more fun than the popular rubber heavy duty toy. Do not hesitate your pup will thank you for this fun distraction.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
D
Verified Purchase
DEBORAH C. JONES
Carnegie, US
★★★★★ 4
Happy with quality & price
Color: Crinkle Duck (Yellow), Size: Large
Lasts longer than most toys for the price Only bought Kong or Outward Hound for my 17 lb Lhasa Apso in the past a
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products