SKU: 69157392152

HRSVA (strain A2) post-fusion glycoprotein F0, His Tag

Sale price$211.50 Regular price$235.00
Save 10%

Pay in installments of $58.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HRSVA (strain A2) post-fusion glycoprotein F0, His TagProduct Specification Species HRSV Antigen HRSVA Synonyms Fusion glycoprotein F2, Fusion glycoprotein F1 Accession P03420 Amino Acid Sequence Gln26 Leu513, with C terminal 6* His

Product Specification


Species HRSV
Antigen HRSVA
Synonyms Fusion glycoprotein F2, Fusion glycoprotein F1
Accession P03420
Amino Acid Sequence

Gln26-Leu513, with C-terminal 6* His QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLGGGSHHHHHH

Expression System HEK293
Molecular Weight 43-45 kDa&18 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Melero J A. et al. (1997) Antigenic structure, evolution and immunobiology of human respiratory syncytial virus attachment (G) protein. J Gen Virol. 78 (10): 2411-2418. 2. Trento A. (2006) Natural history of human respiratory syncytial virus inferred from phylogenetic analysis of the attachment (G) glycoprotein with a 60-nucleotide duplication. J Virol. 80(2): 975-984.

Background

HRSV is a member of the Pneumovirinae subfamily in the Paramyxoviridae family. It consists of a non-segmented, single-strand negative RNA genome packaged in a lipid envelope. The genome of HRSV is about 15.2 kb in length and encodes 10 genes and 11 proteins: NS1, NS2, N, P, M, SH, G, F, M2-1, M2-2, and L. The F protein and G protein are the major surface glycoproteins. Both of them can stimulate the production of neutralizing antibodies. The sequence of the F protein is highly conserved, while that of the G protein is hypervariable. Due to the genetic diversity in the G gene, sequence encoding the second hypervariable region in the C-terminal (HVR2) of the G protein has been used for genotyping of HRSV. According to the genetic characteristic and reactivity with monoclonal antibodies, HRSV is classified into 2 subgroups, A (HRSVA) and B (HRSVB). To date, there are 15 genotypes of HRSVA (GA1-GA7, SAA1, CB-A, NA1-4 and ON1-2), and 24 genotypes of HRSVB (GB1-GB4, SAB1-SAB4, URU1-2, BA1-12, GB5/CB1 and CBB).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69157392152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Trevor K.
Pawtucket, US
★★★★★ 4
smaller than expected
Color: Multicolour20
great price and good selection but a lot smaller than expected. Great for a small breed puppy but 1/2 the item were to small in my opinion for our 8 week labrador pup
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
J
Verified Purchase
Jazzlyn McClure
Houston, US
★★★★★ 5
Large breed approved
Color: Blue
these incredible aggressive chew toys – they've seriously been a game-changer for my pups! I know it's a bit late, but better late than never, right? I've got a couple of power chewers at home, a Rottweiler and a Labrador, and anyone with big dogs knows the struggle of finding toys that actually last. These bad boys have been in constant rotation for over a year now, and I'm genuinely impressed by their resilience. They're incredibly tough! Funnily enough, we originally had three, but now we're down to just one. The others aren't broken, though – I'm pretty sure my dogs just loved them so much they've hidden them away in some secret stash, as they tend to do with their favorite treasures! Beyond just being durable, these toys have been a massive help with their training. They’re fantastic for redirecting all that enthusiastic chewing away from my furniture and shoes, which, let's be honest, is a huge win for any pet parent! Considering how long they've held up to some serious chomping, the price point is absolutely spot on. You definitely get great value for your money.watch your toe they are heavy. If you've got a dog that's a champion chewer, you absolutely need to try these out. They're a lifesaver!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
C
Verified Purchase
Christine Petrowsky
New York, US
★★★★★ 5
Great all around
Color: Blue
We have 4 dogs, lab, pit bull, golden retriever, great dane, I bought 4 sets, they are constantly played and chewed on, and are still around everywhere, great to chew on and play with
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jan Keene
Massapequa, US
★★★★★ 5
Durable chew toy.
Color: Blue
My dog loves these. She chews on them a lot. She seems to like the different shapes. She is part Pit and an aggressive chewer. These chew toys last a long time. And I love the three pack so if we lose one, we always have a spare.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jay
Omaha, US
★★★★★ 4
Decent durability for the price
Color: Blue
Bought a bunch of these for a dog shelter and have to say - decent for the price of you have aggressive chewers. All of the toys are still going 6+ months later, even with the strongest jawed pitty mix. Does get torn up at the ends but can easily be sanded down for a longer lasting toy, unlike some other hard toys with material not meant for sanding. The antler and ring seem to be favorites. The antler even has a divot so you can put soft treats in it or peanut butter and freeze it for a more interactive experience. Some came with a strong beef/liver smell but not overwhelming or off-putting. They are hefty without being too heavy, less likely to damage floors. Overall a good purchase
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products