SKU: 69750297576

Human VAV1 (SH3-2) Protein

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VAV1 (SH3-2) ProteinProduct Specification Species Human Synonyms Proto oncogene vav, VAV Accession P15498 Amino Acid Sequence Protein sequence (P15498, Lys782 Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Expression System E. coli Molecular Weight Predicted MW: 7. 6 kDa Observed MW: 10 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized powder Storage Buffer Lyophilized from a 0. 2

Product Specification


Species Human
Synonyms Proto-oncogene vav, VAV
Accession P15498
Amino Acid Sequence

Protein sequence (P15498, Lys782-Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Expression System E.coli
Molecular Weight Predicted MW: 7.6 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VAV1 is a crucial signaling protein that belongs to the VAV family of guanine nucleotide exchange factors (GEFs). It plays a pivotal role in hematopoietic cells, where it regulates cytoskeletal dynamics, cell migration, and immune responses by activating Rho-family GTPases such as Rac1 and Cdc42. The protein contains multiple functional domains, including a Dbl homology (DH) domain for GEF activity, a pleckstrin homology (PH) domain, and two Src homology 3 (SH3) domains, with the second SH3 domain (SH3-2) mediating protein-protein interactions. VAV1 is primarily expressed in T cells, B cells, and natural killer (NK) cells, where it participates in T-cell receptor (TCR) and B-cell receptor (BCR) signaling pathways. Dysregulation of VAV1 has been linked to autoimmune diseases and hematological malignancies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69750297576

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Axmceach
Birmingham, US
★★★★★ 4
Would buy again
Size: Small
Would have given 5 stars, but my dog was able to chew this down pretty quickly, so not the most durable. I do like that this is made with better material than other dog chews, so I would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Aggressive Chewers
Flavor Name: Bacon-bone shape, Size: Small-under 20LBS
Great for aggressive chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
J
Verified Purchase
Julie
Massapequa, US
★★★★★ 3
Really not for aggressive chewers
Flavor Name: Bacon-2Pcs, Size: Medium/Large-under 60LBS
My 4 year old doodle is a very aggressive chewer. I am always looking for chew toys that will last longer than a day these did not!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
M
Verified Purchase
Melissa
Chelsea, US
★★★★★ 5
Great dog bones
Flavor Name: Variety Flavored, Size: Small-under 20LBS
My dogs really like these bones. They are a very durable material and easy for the dogs to hold onto while they chew. They are resistant to the chewing and don’t fall apart. They keep my dogs entertained and happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
A
Verified Purchase
Angel
Pawtucket, US
★★★★★ 1
NOT for Aggressive Chewers.
Flavor Name: Bacon Flavored, Size: Medium/Large-under 60LBS, Flavor Name: Bacon Flavored, Size: Medium/Large-under 60LBS
I received 2 of these on May 6th and gave 1 to my Golden retriever then gave my Miniature Heeler the second 2 days ago on May 10th. This image is taken on May 12th. It’s too soft to be labeled for Aggressive chewers because with other bones I have previously purchased the bones have been lasting forever. Which has me concerned about how much plastic-like material they’re consuming. I don’t recommend this one for Aggressive or even Moderate chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products