SKU: 7205744888

Biotinylated CD47 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD47 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD47, MER6, IAP, OA3 Accession Q08722 Amino Acid Sequence Gln19 Pro139, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD47, MER6, IAP, OA3
Accession Q08722
Amino Acid Sequence

Gln19-Pro139, with C-terminal Human IgG1 Fc & Avi Tag QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight 55-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

2、Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-27.

3、Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603.

Background

The leukocyte surface antigen CD47 is also known as OA3, integrin-related protein (IAP), and protein MER6. Human CD47 is an integral membrane protein consisting of a 123-amino acid (aa) extracellular domain (ECD) and a single Ig-like domain, five transmembrane regions with short insertion loops, and a 34-aa C-terminal cytoplasmic tail. CD47 is widely distributed in normal adult tissues. CD47 is a receptor for SIRPA, and binding to SIRPA prevents the maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells, thereby protecting cancer cells from elimination by phagocytosis. The interaction between CD47 and SIRPG mediates cell-cell adhesion, enhances superantigen-dependent t cell-mediated proliferation, and co-stimulates t cell activation. CD47 is highly expressed in a variety of solid tumor cells and malignant hematological tumor cells, and its expression level is positively correlated with disease progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 7205744888

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Ethan A.
Draper, US
★★★★★ 5
Brings joy!
Format: Board book
This sweet book brings a smile to my kids faces every time they open it! The repetitive and fun words really engage them and truly bring joy. There are a lot of board books out there - this one definitely deserves its spot on our favorites pile.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2023
K
Verified Purchase
KJ
Pawtucket, US
★★★★★ 5
Adorable with a Surprise Ending
Format: Board book
This story will be loved and cherished by both children and the adults who read it to them. A cute story with an interactive ending. The illustrations bring the author’s story to life. Will become on your children’s’ most requested bedtime story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2023
C
Verified Purchase
Chip Bergstrom
Belleville, US
★★★★★ 5
Great Gift for New Moms
Format: Board book
I bought this book for friends who have a toddler son. As relatively new parents they've been inundated with books, but "Are you Wiggly?" is the clear favorite. They say their son's face lights up every time they reach the very clever conclusion at the end of the story. I am going to buy additional copies for the new families on my street.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2024
A
Verified Purchase
Amy Hennessey
Belleville, US
★★★★★ 5
best baby book
Format: Board book
My daughter in law got this as gift at the baby shower. It is the most precious wonderful book. I now buy it for my friends who are having grandchildren. It is the best message and illustrations !!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2025
M
Verified Purchase
Marina L
Lowell, US
★★★★★ 5
Amazing book
Format: Board book
Really nice book for babies and toddlers. Calm colors, quality pictures, thoughtful text. Makes a great gift to anyone
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025

recommand products