SKU: 72073438936

Mouse IL-13 Protein, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Pay in installments of $36.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-13 Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 13, T cell activation protein P600, Il13 Accession P20109 Amino Acid Sequence Protein sequence (P20109, Ala19 Phe131, with N His tag) APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Expression System HEK293 Molecular Weight Predicted MW: 14. 6 kDa Observed MW: 15 33 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms Interleukin-13, T-cell activation protein P600, Il13
Accession P20109
Amino Acid Sequence

Protein sequence (P20109, Ala19-Phe131, with N-His tag) APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Expression System HEK293
Molecular Weight Predicted MW: 14.6 kDa Observed MW: 15-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence identity to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72073438936

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Matthew Nelson
Los Angeles, US
★★★★★ 3
Please do NOT reship items like body soap that have been returned
Scent: Seagrass & Driftwood, Size: 32 Fl Oz (Pack of 1), Scent: Seagrass & Driftwood, Size: 32 Fl Oz (Pack of 1)
So I've purchased this twice now, I love the scent and I love how it lathers up, overall very happy with the produce so long as I get a product that wasn't previously returned. The 2nd order I received, it was clear that someone had replaced the soap in the bottle with some other kind of liquid and returned it and I got it. First off that has to be dangerous and hazardous. As you can see from the pictures, something is wrong with this product. The first product I got had a clean scent, was clearly a body soap liquid. The 2nd product I ordered was more water, smelled had virtually no scent at all. Unfortunately I had already poured it into my soap dispenser so it's now not returnable. PLEASE DO NOT SHIP OUT RETURNED ITEMS!! It's dangerous
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2024
R
Verified Purchase
Richard Lockwood
Natrona Heights, US
★★★★★ 5
If you have sensitive skin and dont want premium prices, Cremo’s body wash is an excellent option A+
Scent: Palo Santo, Size: 16 Fl Oz (Pack of 1), Scent: Palo Santo, Size: 16 Fl Oz (Pack of 1)
Cremo’s body wash for men has become a staple in our household. The product exudes a luxurious feel, from the rich lather to the clean, long-lasting scent that genuinely resembles a more expensive fragrance. This body wash possesses a pleasant aroma of cardamom, papyrus, and most notably, palo santo. It features a warm, woody, and spicy scent, which is one of my preferred fragrance notes. Notably, the scent is strong without being overpowering. Additionally, I appreciate the aesthetic appeal of the bottle. The exquisite and vintage-inspired packaging complements the fragrance effectively. What truly sets Cremo’s body wash apart is its gentle nature. I have sensitive skin and this body wash does not cause dryness or irritation. In fact, it leaves my skin feeling soft and smooth, which is not always the case with other brands I have tried. The affordability of Cremo’s body wash is a significant advantage. It offers a high-end feel and fragrance without incurring excessive costs, making it an easy choice for repeat purchases. If you or your family have sensitive skin or simply desire a pleasant scent without paying premium prices, Cremo’s body wash is an excellent option. Highly Recommended. 5/5 Stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2025
J
Verified Purchase
Jorge Selman
San Leandro, US
★★★★★ 5
If you want a great soap in a budget, buy Cremo body wash.
Scent: Cypress Santal, Size: 16 Fl Oz (Pack of 1)
Really good soap!! Leaves your skin soft and smells great. Light fragance and provides a good lather.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
D
Verified Purchase
David Percival Flores
Chelsea, US
★★★★★ 5
Beat the Humidity with This Citrus Powerhouse
Scent: Bergamot, Size: 16 Fl Oz (Pack of 1)
​In the middle of a brutal, humid Philippine summer, finding a body wash that actually boosts your confidence is a game-changer. Cremo’s Italian Bergamot isn’t just a soap; it’s a full olfactory experience. It opens with a vibrant, tart Italian bergamot that immediately cuts through the heat, followed by the freshness of vetiver, and the neroli blossom adds a sophisticated floral touch. ​True to Cremo’s Reserve collection, the scent is beautifully layered. It builds in intensity as you lather, allowing the earthy, fresh vetiver to anchor the citrus. Unlike many drugstore options, this lingers—stepping out of the shower, you can still catch the crisp citrus and the clean, woody dry-down on your skin. It’s the ultimate reset for a hot day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
M
Verified Purchase
madeline bohn
Houston, US
★★★★★ 5
Awesome
Scent: Blue Cedar & Cypress, Size: 16 Fl Oz (Pack of 1)
This soap smells fantastic, and leaves you feeling clean! Great find, went back to buy the other scents!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products