SKU: 72412822260

VSIG3/IGSF11 Fc Chimera Protein, Human

Sale price$259.20 Regular price$288.00
Save 10%

Pay in installments of $72.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VSIG3/IGSF11 Fc Chimera Protein, HumanProduct Specification Species Human Antigen VSIG3 IGSF11 Synonyms VSIG3, IgSF11, CXADRL1, Bt IgSF, CT119 Accession Q5DX21 1 Amino Acid Sequence Leu23 Gly241, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen VSIG3/IGSF11
Synonyms VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly241, with C-terminal Human IgG1 Fc

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215–21.

Background

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72412822260

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jojo
Los Angeles, US
★★★★★ 5
I really like this product!
Color: Collagen
I tried these eye patches that stick right under the eyes, and overall they’re really convenient and easy to use. They adhere well to the skin without sliding around, which makes it simple to wear them while relaxing or getting ready. After using them, my under-eye area felt more hydrated and looked a bit brighter and less puffy. The cooling effect was also soothing, especially when I kept them in the fridge before applying. They didn’t cause any irritation, which is a big plus for sensitive skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
R
Verified Purchase
Rhee9701
Lowell, US
★★★★★ 5
Truly impressive
Color: Collagen
I am really impressed with this brand.. Biodance. These collagen peptide eye patches are great for around my eyes and also those pesky laugh lines. Just after a couple of days I’ve seen a noticeable improvement. They have a very nice feel on your face, no skin, irritation, and great value!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
M
Verified Purchase
MAMA V DESIGN STUDIO
New York, US
★★★★★ 4
Good Results, Slightly Dry Texture
Color: Collagen
I recently tried the BIODANCE Collagen Peptide Eye Patches and they worked pretty well for my under-eye area. The patches are packed with collagen peptides and feel nice and cooling when you first apply them. After 20–30 minutes, my skin looked a bit plumper and more hydrated, and the fine lines around my eyes appeared softer. The only downside is that they can be a little dry compared to some other eye patches I’ve used. Overall though, I noticed a visible difference in brightness and smoothness after consistent use for a few days. They’re convenient, easy to use, and do deliver on the anti-wrinkle and hydrating claims to a decent degree. If you don’t mind them being on the drier side, I’d recommend giving them a try — especially for targeting smile lines and tired-looking eyes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
K
Verified Purchase
kilibell
Louisville, US
★★★★★ 5
Biodance my favorite
Color: Collagen
I just used these morning and they made a difference on my eye area, these eye patches left my area very moisturized, with a hint of glow! Most importantly they didn’t slip or move. These will definitely be a buy again purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
Ana
New York, US
★★★★★ 5
Nice First Use, Feels Refreshing and Soothing!
Color: Collagen, Color: Collagen
I just started using the BIODANCE Collagen Peptide Eye Patches a couple of days ago, so this is an early impressions review. The packaging looks nice and the jar is easy to open and store. The patches are well soaked in serum and feel very cooling and refreshing when applied under the eyes. They stick well and don’t slide around, which makes them easy to wear while doing other things. So far, I like how hydrating they feel on my skin. They give an instant refreshed look right after use, especially in the morning. I haven’t used them long enough yet to see long-term results on fine lines or wrinkles, but I’m excited to continue using them and see how my skin improves over time. Overall, first impressions are positive and I think they’re a nice addition to a self-care routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products