Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 25 - Aug 30
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD36/SR-B3 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CD36, SR B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV Accession Q4R6B4 Amino Acid Sequence Gly30 Asn439, with C terminal 10*His
Product Specification
| Species | Cynomolgus |
| Synonyms | CD36, SR-B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV |
| Accession | Q4R6B4 |
| Amino Acid Sequence | Gly30-Asn439, with C-terminal 10*His GDMLIQKTIKKEVVLEEGTIAFKNWVKTGTEIYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLWGYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETGTIGDEKAKMFRSQVTGKINGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 72-82kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Okamoto F. et al. (1998) CD36 abnormality and impaired myocardial long-chain fatty acid uptake in patients with hypertrophic cardiomyopathy. Jpn Circ J. 62: 499-504. 2、Tanaka T. et al. (1997) Is CD36 deficiency an etiology of hereditary hypertrophic cardiomyopathy? J Mol Cell Cardiol. 29: 121-127. 3、Forte E. et al. (2018) The interstitium in cardiac repair: role of the immune-stromal cell interplay. Nat Rev Cardiol. 15: 601-616. 4、Coraci I S. et al. (2002) CD36, a class B scavenger receptor, is expressed on microglia in Alzheimer’s disease brains and can mediate production of reactive oxygen species in response to -amyloid fibrils. Am. J. Pathol. 160: 101-112. |
Background
CD36 belongs to the scavenger receptor class B (SR-B), a family of highly glycosylated transmembrane receptors with a wide range of ligand recognition sites. It has been reported that glycosylation of CD36 is required for trafficking of intracellular CD36 to the cell surface membrane. Because of its wide range of ligands, CD36 has plenty of functions, including but not limited to recognizing and ingesting lipids, participating in the process of inflammatory response, signal transduction, and apoptosis. The expression occurs in monocytes/macrophages and microglia as well as various other cells and tissues, including microvascular endothelial cells, platelets, adipocytes, and the heart. CD36 promotes the podocyte injury in many kidney diseases including primary nephrotic syndrome, obesity-related glomerulopathy, and diabetic nephropathy. Moreover, genetic knockout or antagonist blockade of CD36 could alleviate kidney injury indicating that CD36 is a potential therapeutic target.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy