SKU: 73310105144

FABP5 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP5 His Tag Protein, HumanProduct Specification Species Human Accession Q01469 Amino Acid Sequence Ala2 Glu135, with N terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Expression System E. coli Molecular Weight 17kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris,

Product Specification


Species Human
Accession Q01469
Amino Acid Sequence Ala2-Glu135, with N-terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Expression System E.coli
Molecular Weight 17kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 5(FABP5), epidermis is a protein encoded by the FABP5 gene. The gene encodes a fatty acid-binding protein present in epidermal cells and was first identified as being upregulated in psoriatic tissue. Fatty acid binding proteins are a small, highly conserved family of cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The effects of FABPs are thought to include fatty acid uptake, transport and metabolism. FABP5 has been shown to interact with S100A7.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73310105144

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BobbiJo- SpicyBookswBB
Phoenix, US
★★★★★ 5
So good!
Format: Kindle
Wings of Stars was a fantastic first book to a new series. It grabbed me in its clutches within the first chapter and kept ahold of me. This new world of M Sinclair and RL Caulder’s is all about angels and mythical creatures. It’s full of drama from all points. From Kieran’s awful home life to keeping the stars alive and everything in between. Kieran is our FMC and despite everything she keeps her spirit and defiance. Keeping to their norm, there is a group of guys for our FMC but they definitely aren’t established yet, and not fully cemented yet into being a group rather than her choosing between them. Ronan is so sweet and gives off Daddy vibes Gabe is also sweet and wants the best of everything for Kieran and will defend her against anyone Bastian is slightly unhinged but I loved him immediately Steele is a jerk… just as you find redeeming qualities, he screws up again… but yet I still want him to redeem himself. There’s another one… but if I gave his name I would be spoiling a plot twist so you will just have to find out yourself… but you’ll love him as much as I do. This is a slow burn but the little bit of spice we do get is hot, especially with the dirty talk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2024
G
Verified Purchase
Gabby C.
Pawtucket, US
★★★★★ 5
Angels and the Fallen — Breathtaking Start
Format: Kindle
This book was EVERYTHING I expected it to be and more. Leave to R.L. Caulder and M. Sinclair to give us yet another amazing book! Kieran and her guys hooked me from the very beginning and did not let go. Found family is one of my favorite tropes and it was done so well in this book. Couple that along with an FMC trying to find her place in the world and I was practically drooling over this book. The world building, the conflict, the wyverin sidekick — it all was done so well that it felt fresh and real. Each love interest felt real and unique in their own ways. I felt connected to each one and like they were truly different people. I love that so much in a book and these two authors never miss with their love interests. Multi POV, Reverse harem, who did this to you, and a magical world highlighting the angels and the fallen. This book has everything and it does it so well. Big thank you to R.L. Caulder and M. Sinclair for the arc copy! I cannot wait for book 2!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2024
C
Verified Purchase
Chrystal
Bozeman, US
★★★★★ 4
A new take 🤔
Format: Kindle
I’m not going to go into what this book is about — by now you e already read the synopsis and have an idea — but I will give a couple of insights. Definitely a different take on angels and their fall; I like it. This is an interesting start to a new series - YES, this does end on a cliffhanger so be prepared for that. I’m eager for the next book (and hopefully the last in this series — sometimes the author(s) will switch it up depending on how the story flows for them) in this series. I’m hoping that a certain male character redeems himself because he’s a dick that will make the meaning of mixed signals jealous lol. You ever watch that old movie — I think it’s call Mommy Dearest? — yea, let’s switch that up to daddy. That man would make a perfect husband to mommy dearest. I recommend this book because while these authors are well known for their cliffhangers, they are also well known for putting out good stories.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2024
M
Verified Purchase
M Weidner
Dallas, US
★★★★★ 3
Liked it
Format: Kindle
I liked the worlds and the characters. The prophesy is confusing in that I would think, since all worlds ore on a path to destruction, the angels would want their world to be saved. I am sure there is more evil that will be revealed as the series proceeds. I dislike a prolonged “poor little me” trope and the main character has moved past that, thankfully, and began to show a fierce attitude as the novel progressed. The last portion of the novel had some great action. It’s worth reading, just be patient with a slow start.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2024
C
Verified Purchase
C. COOK
Omaha, US
★★★★★ 5
Could not put this book down!
Format: Paperback
Binge read quality!! Finished in 2 days I was in a dilemma with this book. I couldn't wait to finish because it was so good, and yet I didn't want it to end, because it was so good. Staying up til 2:30am is the highest complement I can give to a book. Current day with Gothic feel. The story pulls you in immediately, and there is never a part where it feels dull, or that you need to skip through. Mysterious with plot twists, especially the end. I love how there were flashbacks from the past intertwined with present day. Gave a great backstory that only came together at the very end. Spicy for sure, and fit in perfectly with story. Great character development so that you could empathize with both of the main characters.. Lucian and Isa. Check Trigger warnings first! Highly recommend this book
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026

recommand products