SKU: 73714798192

JAM-C Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

JAM-C Fc Chimera Protein, HumanProduct Specification Species Human Antigen JAM C Synonyms CD323; JAM 2; JAM3; JAMC; JAM C; JAM CFLJ14529; junctional adhesion molecule 3JAM 3; junctional adhesion molecule C Accession Q9BX67 Amino Acid Sequence Val32 Asn241, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen JAM-C
Synonyms CD323; JAM-2; JAM3; JAMC; JAM-C; JAM-CFLJ14529; junctional adhesion molecule 3JAM-3; junctional adhesion molecule C
Accession Q9BX67
Amino Acid Sequence

Val32-Asn241, with C-terminal Human IgG Fc VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 57-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Chavakis, T. et al. (2003) Thromb. Haemost. 89:13.2.Aurrand-Lions, M. et al. (2001) Blood 98:3699.3.Spermatid differentiation requires the assembly of a cell polarity complex downstream of junctional adhesion molecule-C.Gliki G., Ebnet K., Aurrand-Lions M., Imhof B.A., Adams R.H.4.Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.Lamagna C., Hodivala-Dilke K.M., Imhof B.A., Aurrand-Lions M.

Background

The family of junctional adhesion molecules (JAM), comprised of at least three members, are type I transmembrane receptors belonging to the immunoglobulin (Ig) superfamily. These proteins are localized in the tight junctions between endothelial cells or epithelial cells. Some family members are also found on blood leukocytes and platelets.Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes.Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow.At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3.Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium.Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation.Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN).Plays a role in angiogenesis.Plays a role in the regulation of cell migration.During myogenesis, it is involved in myocyte fusion.Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73714798192

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Tati
Fort Morgan, US
★★★★★ 4
Halo patches
I tried the Halo Dot Ultra Thin Pimple Patches, and overall I’m really impressed with them. In terms of effectiveness, they work well at helping bring pimples to a head and protecting spots overnight so they don’t get worse or irritated. The value for money is good since you get a decent amount in the pack and they’re thin enough to use during the day or night without being too noticeable. They’re super easy to use—just clean skin, place the patch, and go—and I like that they stay in place pretty well. I also find them pretty versatile, since you can wear them at home or out and about if you get a discreet one. For skin sensitivity, they’ve been gentle on my skin with no irritation, which is a big plus for me. Overall, they’re a simple, effective skincare staple I’d definitely keep on hand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
C
Cheeky M.
Los Angeles, US
★★★★★ 5
Nice patches -- Fair price -- has sulfur!
This is a review for the Halo Dot™ Pimple Patches for Face, Hydrocolloid Acne Patches with OptiMSM®, Visibly Shrinks Zit & Whitehead- Comes with Travel Essentials Inner Pouch (33 PATCHES) ($12.59) PROS: Price -- a fair deal for 33 patches and consistent with pricing of most other similar patches online. The inclusion of sulfur (this OptiMSM business) makes these unique also -- I can't seem to find others on Amazon with similar formulation, so these are intriguing. Sulfur is known for antimicrobial properties and can be helpful for zits and a little bit gentler on your skin than benzoyl peroxide or salicylic acid -- but anytime I put any sulfur stuff on zits that are above or around my eyes, it seems to migrate INTO my eyeball while I'm asleep and man is that uncomfortable. This little patch solves that dilemma nicely by keeping the sulfur put. CONS: none that I can see; these are a nice entry into the hydrocolloid acne patch space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
J
Jennifer
Massapequa, US
★★★★★ 3
Disappointing results and poor adhesion.
I love Hydrocolloid pimple patches. I have used at least half of the brands available for sale and even the non brand ones. I’ve also used the hydrocolloid sheets and cut them to size and the hydrocolloid gel bandaids and used for pimple patches. I love how they help along the healing and keep me from picking at the pimple. This brand I wasn’t impressed by. None of them stayed on my face for half the night. The one that remained in place the longest out of the 4, didn’t show any signs of improvement. The longest they kept in place was 3 hours. I had to reapply and I still handbrake noticed any signs of healing after using one full sheet on 4 smaller sized blemishes because the adhesive wasn’t working.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
N
NK
Phoenix, US
★★★★★ 5
Stops Me From Picking and Actually Works
As a woman in my 40s, I never would have guessed I’d still need pimple patches, yet the occasional zit still pops up — and these things are like magic. They work really well, blend into my fair/light skin nicely, and are barely noticeable at a quick glance. I’m also a terrible picker, and picking is so bad for your skin, so I love that these keep me from messing with pimples while doing all the work for me overnight. I’m always grossly fascinated by how much gunk they pull out by morning. Very happy to have these in my little skincare emergency arsenal.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
E
Elis
Draper, US
★★★★★ 5
Camouflages well with the skin and sticks long enough
I was excited to try these Halo Dot patches because I was having some breakouts before a wedding I had to attend. I put these on three nights before the wedding only at nights and left them on until the morning. I washed my face the 1st night, yet the second night I did not and it still attached (mind that I have a very oily face by the end of the day). With every application I saw good results as the breakouts were being reduced with each use. It is easy to put on and to carry out if you need to travel because it comes in two separate little envelope like package that you can put in a backpack/purse. These are thin and are almost not visible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products