SKU: 76278684586

Siglec-15 Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Siglec-15 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q6ZMC9 1 Amino Acid Sequence Q6ZMC9 1, Phe20 Thr263 with C terminal human IgG Fc

Product Specification


Species Human
Accession Q6ZMC9-1
Amino Acid Sequence

Q6ZMC9-1, Phe20-Thr263 with C-terminal human IgG Fc FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

57-65 kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Siglec-15 is a critical immune suppressor with broad upregulation on various cancer types and a potential target for cancer immunotherapy. Siglec-15 has unique molecular features compared with many other known checkpoint inhibitory ligands. It shows prominent expression on macrophages and cancer cells and a mutually exclusive expression with PD-L1. As a new player in the cancer immunotherapeutic arena, Siglec-15 may represent a novel class of immune inhibitors with tumor-associated expression and divergent mechanisms of action to PD-L1, with potential implications in anti-PD-1/PD-L1-resistant patients. Siglecs are cell surface proteins that bind sialic acid. They are found primarily on the surface of immune cells and are a subset of the I-type lectins. Siglec-15 consisting of immunoglobulin (Ig)-like domains, transmembrane domain and a short cytoplasmic tail. Siglec-15 is that recognizes sialylated glycans and regulates osteoclast differentiation. Siglec-15 is a potential therapeutic target for osteoporosis and plays a conserved regulatory role in the immune system of vertebrates.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76278684586

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carolyn T
Omaha, US
★★★★★ 3
Smaller then you think!
Color: Dark Brown
This purse is GORGEOUS! I just wished it was bigger. I guess that’s my fault for not paying attention to the measurements. Even in the pictures with the models it looked bigger Not enough room for me so I sent it back
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
K
Verified Purchase
KiKi
Los Angeles, US
★★★★★ 1
Shipping department dropped the ball
Color: Dark Brown, Color: Dark Brown
I am ashamed that Amazon would claim to be an outfit that deals in luxury bags. The packaging and merchandise handlers really dropped the ball. The purse was very nice and well made. ( with the exception of the long strap 👎 ) it’s a shame this bag was tossed in the box that way I received this leather bag it was all wadded up and wrinkled in all the wrong places such as a huge wrinkle across the bottom. $139. For a bag that’s looks like it’s been in the corner of someone’s closet for months or maybe like the UPS truck ran over it. Not cool. Luxurious expensive merchandise you would expect at least a little care and packaging and handling. Disappointed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2025
D
Verified Purchase
DL
Lake Worth, US
★★★★★ 5
Absolutely soft leather
Color: Coffee
I ordered the coffee color, absolutely love it.Super soft- I have ordered brands that cost 4xs as much & returned because of stiff leather. The zippers simply glide.I love all the different zipper pockets, I like having a place for everything, my phone fits perfectly in the back side zipper area. The front magnetic for my key fob.Zipper above to get out quick cash.I had a hard time deciding which color I wanted! It's roomy enough inside but not too big where Im going to carry things I dont need. It's nice having 2 straps to trade out- im starting with the guitar strap- like that it is adjustable straps & on swivel hooks.And you can really smell the genuine leather. For my preference I would have liked it to have been 2 to 3 inches shorter height wise as I was looking to replace a few bags I used when flying but this is perfect for an everyday crossbody.This bag looks very well made. Nothing fancy on the inside. Plan on searching for this brand in smaller size and some soft colors for spring & summer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
T
Verified Purchase
Tabatha
Houston, US
★★★★★ 5
So incredibly happy with this purse! You will be so happy you bought this. Beautiful!
Color: Brown
Thrilled from the start! Real leather , the zipper hardware great quality. Love the guitar strap. Love all of the pockets. Great purse, great design! Real genuine leather!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
M
Verified Purchase
M. Gordon
Omaha, US
★★★★★ 5
Definitely would recommend
Color: Brown, Color: Brown
This bag had soft leather and looked just like the picture on the product page. There is the main compartment, two zippers and two slip pockets on the inside. I do like the bag, but I don’t usually like slip pockets because a lot of times when you’re just throwing things into the bag items might go into a slip pocket without you realizing it. I didn’t pay attention to this when I bought the bag, but I still really like it. On the back is a large compartment with a zipper. On the front is another large compartment with a zipper and a pocket with a magnetic snap. I bought the brownish color one and it’s really beautiful. I would definitely recommend it. It does come with two straps I am trying out the one they call Boho for now. It is very nice. The other one which I guess is leather also is much thinner.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026

recommand products