SKU: 76385581102

FKBP12 His Tag Protein, Human

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FKBP12 His Tag Protein, HumanProduct Specification Species Human Synonyms FKBP 12, FKBP 1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE Accession P62942 Amino Acid Sequence Met1 Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH Expression System E. coli Molecular Weight 13kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE
Accession P62942
Amino Acid Sequence

Met1-Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH

Expression System E.coli
Molecular Weight

13kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Curr Genet. 2021 Jun;67(3):383-388.
2. Genetics. 1999 Mar;151(3):935-44.

Background

FKBP12 associates with several large protein complexes, including the multi-drug resistance pump and the ryanodine, inositol trisphosphate (IP3)and the type I TGF-β receptor. FKBP12 was originally identifed as a FK506 binding protein. FK506 is a clinically used immunosuppressant derived from Streptomyces tsukubaensis. The FK506–FKBP12 binary complex inhibits the protein phosphatase calcineurin, thereby preventing T lymphocytes from producing interleukin-2 in mammals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76385581102

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Schamy
Whiting, US
★★★★★ 5
Durable & great deal
Color: Orange and Yellow
My foster German Shepherd has a jaw that's locked and loaded but love these cause I can play tug of war or fling it way across the yard. He's chewed or busted every ball he's received except these. I'm loving them. Very durable, bounces too really well and I can find it easily with the colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
A
Verified Purchase
Amy
Pawtucket, US
★★★★★ 4
Small balls and came apart
Color: Orange and Yellow
My dog loves them; these are my first set of this type of toy. Good quality materials, but the knot in the rope came undone and the ball came off in 3days. I had someone fix and re-tie and it has held up so far. The next set I’ll get in a larger size, they’re a tad small for my dog’s mouth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2025
P
Verified Purchase
PJ
Grantham, US
★★★★★ 1
Ball
Color: Blue
Only lasted about 10 minutes and my dog chewed through the rope.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
B
Verified Purchase
Brian berns
Whiting, US
★★★★★ 3
Very very hard ball
Color: Orange and Yellow
These balls are nice, but a little bit harder than I thought they would be
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
N
Verified Purchase
Nikki Szewczyk
Los Angeles, US
★★★★★ 5
The Chuck Norris of Dog Toys
Color: Orange
If dog toys were superheroes, the Nevperish K9 Training Ball would be Batman—indestructible, effective, and always ready to save the day. This thing flies. I’m not saying I could take out a rogue squirrel in a single throw, but… let’s just say those little guys know to keep their distance now. My 100lb German Shepherd, who we affectionately call "The Toy Terminator," has destroyed every squeaky, chewy, or bouncy thing in her path. But this? This glorious, rope-swinging masterpiece? She’s met her match. It’s like her teeth have signed a peace treaty with this toy. Speaking of flying, if you have neighbors with a backyard that’s less than a football field away, be prepared for some fence-hopping cardio. I’ve had more awkward encounters with my neighbors than I care to admit. Thankfully, my shepherd has learned the art of the double hop—over their fence and back—like some four-legged ninja gymnast. Bonus: great entertainment for the neighbors. This toy isn’t just a ball on a rope; it’s a lifestyle. Open fields? Perfect. Tug-of-war? Immaculate. Backyard fetch? A cinematic masterpiece. It’s basically the Swiss Army knife of dog toys, minus the danger of accidental stabbing. Pro tip: Don’t underestimate how far this thing can go. My first throw ended with the ball in orbit—or maybe it just bounced off a satellite. Either way, my dog was thrilled, and now I need an arm warm-up routine before playtime. So, if you want a toy that’ll outlast your dog’s dental fury and make fetch sessions the stuff of legend, this is it. 10/10, would absolutely get weird looks from neighbors again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2025

recommand products