SKU: 76398151096

FABP5 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP5 His Tag Protein, HumanProduct Specification Species Human Accession Q01469 Amino Acid Sequence Ala2 Glu135, with N terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Expression System E. coli Molecular Weight 17kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris,

Product Specification


Species Human
Accession Q01469
Amino Acid Sequence Ala2-Glu135, with N-terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Expression System E.coli
Molecular Weight 17kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 5(FABP5), epidermis is a protein encoded by the FABP5 gene. The gene encodes a fatty acid-binding protein present in epidermal cells and was first identified as being upregulated in psoriatic tissue. Fatty acid binding proteins are a small, highly conserved family of cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The effects of FABPs are thought to include fatty acid uptake, transport and metabolism. FABP5 has been shown to interact with S100A7.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76398151096

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
DadoMultimedia
Dallas, US
★★★★★ 3
Es una buen cargador inalámbrico, pero su mal ensamblaje hizo que no funcionara al inicio.
Color: Best Dad-brown, Color: Best Dad-brown
Estaba bastante emocionado de tener éste cargador inalámbrico para mi celular. Me gustó mucho el diseño de la bandeja hecho en piel. (según la descripción) Lamentablemente, no funcionó con mi celular, tengo un iPhone 12 pro max, que funciona perfectamente si lo cargo con cualquier otro cargador inalámbrico, pero con éste cargador no funcionó, simplemente se quedaba la luz led en color azul parpadeando. Y según las instrucciones es porque no está bien acomodado en la bandeja ó que está protegiéndose de un sobre-calentamiento, pero nada que ver con ello, ya que lo estuve probando acomodándolo de distintas maneras y comparándolo al mismo tiempo con otro cargador donde sí funcionaba mi celular sin problemas. Cabe mencionar que las pruebas fueron hechas sin tener ningún estuche protector en el celular que pudiese interferir con la conexión inalámbrica del cargador. Simplemente éste cargador no estaba funcionando. Quedé desilusionado, ya que ére era el propósito de tener éste cargador, ya que usar sólo la bandeja, el precio por éste producto sería exageradamente alto. Bandeja y cargador es una buena idea, pero la bandeja sin un cargador que no funcione, no tiene caso. En el último momento decidí abrir (soy técnico en electrónica) para revisar porque no estaba funcionando, y descubrí que la bobina que funge como imán, estaba despegada de donde debería estar posicionada por causa de un mal ensamblaje. Así que simplemente la coloqué en el lugar que debería de ir añadiendo un poco de pegamento para reforzar que no se vuelva a despegar. Hice prueba nuevamente, y el celular ésta vez fue detectado sin problemas y cargando. En conclusión, la idea de ésta bandeja con el cargador es muy buena, el producto es muy bueno en cuanto a la calidad de la piel, lamentablemente un mal ensamblaje termina haciendo que demerite la calidad del producto. Iba a dar 2 estrellas, sin embargo, al encontrar la falla, subo a 3 estrellas, ya que el producto en si es bueno, pero el mal ensamble, como mencioné, le resta mucho, ya que podría haber llevado a que éste producto ya fuera inútil.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2024
T
Tiffany Detweiler
Grantham, US
★★★★★ 5
Beautiful
Color: Best Dad-brown
I got this for my husband for Father’s Day and I know he’s going to love it! It’s very simple with a beautiful colored leather, great stitch/leather quality, a hearty quote with a cute design, and perfect size for what is usually kept at the bedside.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2025
B
Billy Bonds
Pawtucket, US
★★★★★ 5
Good looking and the wireless charging works great
Color: Best Dad-brown
I have a confession to make, I(a dad) bought this for myself. I was looking for something to keep on the night stand next tot he bed without getting to big. I only wanted something to charge my phone and put the tv remotes in, I have no interest in keeping my keys, watch or spare change in reach of our younger children....most of the other options I found were much bigger for all those purposes. This one is well made, looks great, and the wireless charger is very easy with my iphone, even while in its case. I dont even need to center it in the charging pad, which was my only fear. I can lay my phone anywhere in there and it charges flawlessly. If you are looking for a gift for your dad, I would not hesitate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2024
P
Patrick Roggie
Lexington, US
★★★★★ 5
Charger works great, tray is solid
Color: Best Dad-brown, Color: Best Dad-brown
I've only used wireless chargers in passing before, and always had issues with them consistently 'activating.' I've had no issues with this one at all, the tray makes it very easy to line it up. Slide the phone all the way into the groove and it's charged flawlessly for me. My phone does have a case, though it's not a very thick one like an otterbox, which I imagine would make the charging more inconsistent. The tray as a whole is very solidly built and well made, it is listed as 'vegan leather' so I'm assuming it's not actual leather, but you honestly can't tell the difference. My biggest complaint is how cheesy the saying on the tray is (even though I am a dad), but that is well worth putting up with for how nice the tray is.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2024
P
Pronounce
New York, US
★★★★★ 4
Not bad, but charger didn't work with my phone
Color: Best Dad-brown
I have several organizing trays on my desk (basic, nothing as nice as this box), and so I thought to reduce the clutter on my desk further by incorporating my QI charger with an organizer tray. Unfortunately the QI charger in the organizer wouldn't link up to the QI charging coils of my phone. Whereas the organizer's charger did work with my wife's S24 Ultra, and my phone has been working on a separate QI charger. The whole point in spending this much money on this organizer is for the QI charger. Without the charger working it's just too expensive as an organizer. Yes, it has a leather look to it, but even with that finish I'd say $25 max would be all I'd be willing to pay for such an organizer. So this a cautionary point. If you give this as a gift it may not work with the recipients phone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2024

recommand products