Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 24 - Aug 29
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage
Product Specification
| Species | Human |
| Synonyms | LFABP |
| Accession | P07148 |
| Amino Acid Sequence | Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | ＞95% by SDS-PAG E& RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 27 reviews
Sort
Product Reviews
★★★★★ 5
Dog friendly
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
My chihuahua loves these chicken tender lollipops
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
★★★★★ 3
🤷🏻♂️
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
Need to make sure you are supervising your dog. With in minutes my small terrier had the stick end down her throat with the whole ring end in her mouth. Had to hold the stick end and let her chew on the ring end. Lasted about 20 minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
★★★★★ 5
Favorite treat of all time for our Maltese pup.
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
These are my Maltese dog’s favorite treat. I don’t know if it is the whole combination of shape, taster, tendon location, or that they are from a Turkey, but they are an absolute winner when we have them.
Since they are quite expensive, we only get them on occasion. If they were less expensive, even by 10%, I would justify regular purchases of them to myself.
I highly recommend them for any size, breed, or reason. They are an exceptionally wonderful treat for my pup.
I think I have just found the reason for ordering another order of these Turkey Tendon lollipops for my best friend. Especially since he eats them quite quickly, even though he is only four pounds. And they seem to be quite digestible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
★★★★★ 5
Perfect treat for my Dolcé!
Pattern Name: Bone, Size: 0.53 Ounce (Pack of 4)
My 14 pound Maltipoo LOVES these. It keeps her occupied for a good 30 minutes. Be sure to get the bone-shaped ones because little dogs will choke on the lollipop-shaped ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
★★★★★ 5
My dogs love these!
Pattern Name: Ring, Size: 0.42 Ounce (Pack of 10)
I have three very large dogs who absolutely love these treats. They are very picky because they’re very spoiled! But yes, they love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026