Pay in installments of $49.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 30 - Sep 4
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
S100B Protein, HumanProduct Specification Species Human Accession P04271 Amino Acid Sequence Ser2 Glu92, with N terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Expression System E. coli Molecular Weight 11 12 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at less than 1
Product Specification
| Species | Human |
| Accession | P04271 |
| Amino Acid Sequence | Ser2-Glu92, with N-terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Expression System | E.coli |
| Molecular Weight | 11-12 kDa(Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | No Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
S100B is a small calcium-binding protein in the neuronal system, and belongs to the S100 family. S100B proteins are a family of 25 homologous intracellular calcium-binding proteins characterized by EF hand motifs, low molecular weights (9–13 kDa), ability to form homodimers, heterodimers and oligomeric assemblies, and are characterized by tissue and cell-specific expression. They are solely present in vertebrates. S100B protein is mainly expressed in the neuronal system such as astrocytes, maturing oligodendrocytes, dendritic cells, and Schwann cells. However, some other cells outside the brain, like kidney epithelial cells, ependymocytes, chondrocytes, adipocytes, and melanocytes, can also express S100B protein.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy