SKU: 77307273862

Apo-SAA2 His Tag Protein, Human

Sale price$585.00 Regular price$650.00
Save 10%

Pay in installments of $162.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apo-SAA2 His Tag Protein, HumanProduct Specification Species Human Synonyms Apo SAA2, SAA, SAA2, Serum Amyloid A2 Accession P0DJI9 Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Expression System E. coli Molecular Weight 13. 2 kDa Purity 95% by SDS PAGE and RP HPLC Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 25mM Arg, 20mM Tris

Product Specification


Species Human
Synonyms Apo-SAA2, SAA, SAA2, Serum Amyloid A2
Accession P0DJI9
Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Expression System E.coli
Molecular Weight 13.2 kDa
Purity

>95% by SDS-PAGE and RP-HPLC

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 25mM Arg, 20mM Tris-HCl, 150mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

SAA is similar to CRP and is used to evaluate the acute reaction process. SAA is a sensitive parameter. It begins to increase after about 8 hours of inflammatory reaction, and the time to exceed the upper limit of the reference range is earlier than that of CRP. However, the difference between the median value of CRP in normal people and the upper limit of the reference range is about 10 times. In SAA, it is only 5 times. For mild infections, for example, many viral infections, elevated SAA is more common than CRP. In infectious diseases, the absolute increase of SAA is higher than that of CRP, so the determination of SAA, especially for "normal" and minor acute reactions, should provide better differentiation. SAA is usually elevated in patients with a cold about 2pm 3, but CRP is also elevated in patients with less than 1pm 2. In viral infection cases, elevated concentrations of SAA and CRP were found in patients with adenovirus infection. The response patterns of SAA and CRP are parallel in the recovery phase of acute infection, which is suitable for both bacterial and viral infections. SAA was not elevated in lupus erythematosus and ulcerative colitis. The increase of SAA in the stage of malignant tumor metastasis is usually higher than that in the organ stage of the tumor. SAA detection is a very sensitive index for transplant rejection. In a study of kidney transplant recipients, 97% of the tests for rejection were based on elevated SAA. In the detection of irreversible transplant rejection, the average concentration was 690 ±29mg/L, while the correlation level in patients with reversible rejection was 271 ±31mg/L. A chronic increase in SAA concentration in patients with rheumatoid arthritis, tuberculosis or leprosy is a prerequisite for the synthesis of AA- starch fibers, which is also used to diagnose secondary amyloidosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77307273862

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michelle H
Port Orchard, US
★★★★★ 5
Perfect puppy toy!
Color: Pig Balls
The best puppy toys! These will have your pup happy as can be and well worth it! They are extremely loud so fair warning but bringing joy to your dog makes it worth it. Durable for a dog who doesn’t destroy things. Size of a clementine
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
D
Verified Purchase
DH
Chelsea, US
★★★★★ 5
Puppy loves them!
Color: Pig Balls
I boutgh this for my foster puppy that loves squeaky bouncy toys and she LOVES them, she carries one with her everywhere. It is great to play fetch or for her to play by herself, it keeps her occupied. For reference she is a 7m old 30lb Heeler/Pit mix and very much a puppy chewing and ripping everything off. These have hold pretty well, we've had them for a few weeks now and they are still going.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
R
Verified Purchase
RB
Waukegan, US
★★★★★ 5
Good product
Color: Pig Balls
Aussie loves them. He is a ball nut. Hours of play with them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
G
Verified Purchase
Gina
Fort Morgan, US
★★★★★ 5
Perfect for small dogs like a Maltese
Color: Pig Balls
My small dogs love them, I have a small poodle and a small Maltese. These balls are a perfect size for their small mouths and have the cutest sound. We have had them almost a month and they haven’t got tore up yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
S
Verified Purchase
Sarah A
Birmingham, US
★★★★★ 5
Great fun for my small pup
Color: Egg Balls
My 15lb Pom loves anything that sqweeks so these little eggs are perfect for him. They are fun to throw since they bounce in all different directions. Considering how many you get it's worth purchasing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026

recommand products