SKU: 77344392525

Human CD86, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD86, His tagProduct Specification Species Human Synonyms Activation B7 2 antigen, B70, BU63, CTLA 4 counter receptor B7. 2, FUN 1, CD28LG2 Accession P42081 Amino Acid Sequence Protein sequence (P42081, Ala24 Pro247, with C 10*His)

Product Specification


Species Human
Synonyms Activation B7-2 antigen, B70, BU63, CTLA-4 counter-receptor B7.2, FUN-1, CD28LG2
Accession P42081
Amino Acid Sequence

Protein sequence (P42081, Ala24-Pro247, with C-10*His) APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 27.2 kDa Observed MW: 40-55 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein constitutively expressed on dendritic cells, Langerhans cells, macrophages, B-cells (including memory B-cells), and on other antigen-presenting cells. Along with CD80, CD86 provides costimulatory signals necessary for T cell activation and survival. Depending on the ligand bound, CD86 can signal for self-regulation and cell-cell association, or for attenuation of regulation and cell-cell disassociation. When bound to CTLA-4, CD86 can be removed from the surface of an APC and onto the Treg cell in a process called trogocytosis. Blocking this process with anti-CTLA-4 antibodies is useful for a specific type of cancer immunotherapy called "Cancer therapy by inhibition of negative immune regulation".

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77344392525

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JohnF
Draper, US
★★★★★ 2
Durability
Color: Blue, Color: Blue
won’t give this product 1 star because my dog still had a good time with it for a few hours. After opening and preparing it, I gave it to my dog and it definitely caught his interest. However, when he chewed on it, plastic pieces started breaking off and he began swallowing them. This product is definitely not suitable for aggressive chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
A
Verified Purchase
Anne
Chelsea, US
★★★★★ 5
Winner !!!
Color: Orange
This amazed us. For perspective, we're talking about a three year old white german shepherd who if he's in the mood, has and can kill a toy within minutes or oddly enough be gentle with furry balls and carry them around as if they are his babies. He's an odd duck. Anyway, since he was a pup, and to this day, he'll play and entertain himself, he'll grab a ball, throw it up in the air, then pounce on it as if it's from outer space. It's really quite cute and funny. Because of those two things I was looking for something interactive that would entertain him and confuse him....let's be honest, watching a confused dog is one of life's great pleasures. I tried two other interactive balls and they were crushed immediately. After reading a lot of reviews, people with german shepherds said this ball actually had a life span. I thought the third time could be the charm and ordered one. Well, I think it actually may be from outer space because he's obsessed with it and hasn't taken a bite out of it. He hasn't once chewed it or even teared little pieces off. The three settings are great. Sometimes he likes one better than another, then forgets about the others. I'll change it up to one he hasn't seen in a while and the whole game starts over again. He'll throw it up in the air as he does with his others, watch it and try to figure out which way it's going to go. And yes, he will pounce on it if he times it right. The size is perfect, it's heavier than your average ball but, that's what make it sturdy. I have to sneak it away when he isn't paying attention to charge it, otherwise he'll sit, stare and cry if he knows it's on the counter charging. It's a lot of fun for all of us. I'm so happy I bought it...... I say give this ball a chance even if you have a beast with killer instincts. I'm buying another for a friends 2 year old golden retriever granddog. Thank you Cheerble.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
J
Verified Purchase
J. Rogers
Natrona Heights, US
★★★★★ 5
This is a great ball for high energy dogs.
Color: Blue
I have a Belgian Malinois, so you can imagine the Maligator jaws. Just opened this today and let her play with it indoors. She LOVES IT. It wore her out and it’s a toy she can really stay focused on without needing me to throw or roll for her. It moves on its own! I supervised her play. I was hoping it was too big to get under the couch, but no. It goes right under it. I had to block off the gap so I didn’t have to keep getting it out from under for her. The outter “shell” is very durable! When she had resting moments, she chewed it pretty good - I could hear the material squeaking against her teeth. I was worried she was tearing it up, but nope! Not a mark on it. It’s easy to set up and operate. It needed charging before play. After hours of play, she was able to somehow unscrew the outter shell. This concerned me bc the smaller, inner ball mechanism came out but I saw it right away and was able to put it back together. So, make sure it’s screwed together tightly (which I thought I had done without breaking it) and check it from time to time to make sure it hasn’t loosened. This is a great ball for her incredible high energy drive. It gives her the work and fun play she needs to get tired, which I love. This toy is on the expensive end, but so far it’s worth it. Now we’ll see how long it lasts!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2025
C
Verified Purchase
Carol D
Phoenix, US
★★★★★ 5
Love love it
Color: Blue
Best dog toy ever. I have a 1 year old boxer who is full of energy (understatement). This ball has provided more entertainment for us both than any dog toy I’ve ever purchased. Charge holds well and has a very resilient shell. I love it. Worth the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
M
Verified Purchase
Megan
Pawtucket, US
★★★★★ 4
Great ball for limited entertainment. Replaceable outer shell is an amazing option!
Color: Blue, Color: Blue
Bought this for our 45lb, ball-obsessed Dutch shepherd/pit bull dog mix. I had one of these years ago with the hard shell and couldn’t be happier with the new foam shell. The new foam shell is much quieter and while our dog might put holes in it with his teeth, he doesn’t seem to ever pull pieces off. For engagement level, he found it VERY interesting at first and was scared to grab it, but once he got over that he started holding it in his mouth even when it shakes and just tries to keep it. Isn’t the best for fetch or anything as he has trouble letting it go when it is actively moving, but it makes him happy while he has it. We just make sure to monitor him while it is out. The ability to change the outer shell and just buy a replacement for the shell instead of a whole new toy is a lovely feature that makes me very happy to continue buying from this company.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026

recommand products