SKU: 87907554442

Mouse CD105, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD105, His tagProduct Specification Species Mouse Synonyms Cell surface MJ7 18 antigen, Edg Accession Q63961 Amino Acid Sequence Protein sequence (Q63961, Glu27 Gly581, with C 10*His)

Product Specification


Species Mouse
Synonyms Cell surface MJ7/18 antigen, Edg
Accession Q63961
Amino Acid Sequence

Protein sequence (Q63961, Glu27-Gly581, with C-10*His) ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 61.7 kDa Observed MW: 75 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Endoglin (ENG) is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex. It is also commonly referred to as CD105, END, FLJ41744, HHT1, ORW and ORW1. It has a crucial role in angiogenesis, therefore, making it an important protein for tumor growth, survival and metastasis of cancer cells to other locations in the body. It is involved in modulating a response to the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, BMP-7 and BMP-9. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87907554442

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Katie A.
Port Orchard, US
★★★★★ 5
Good paper towels.
At the time of my review this set of 16 double layered paper towels are going for about $18.99. Not a bad price for a namebrand paper towel. I usually use Great Value paper towels because they are not only inexpensive but have good absorbency so it was interesting to compare it to the Scott namebrand, whom I use just about exclusively for my toilet tissue. The papertowels worked well as I expected them to but I did not specifically see a dramatic difference between it and the ones I usually used. The only noticeable differences to me were: - Scott paper towels had a prettier pattern - Scott paper towels visually had a much more tidy design and *looked* higher quality - Scott paper towels felt softer to the touch As for absorbency though? I felt like they performed identically. And trust me, we burn through paper towels. We have two small children and still have to wash bottles daily. So, we try to balance cost versus efficacy for papertowels because we use them so much every day. For the what they are these are great, but I will probably stick to the other brand unless I'm in a pinch and need to order papertowels more conveniently OR if these ever go on sale or have a coupon. I don't need my papertowels to look or feel pretty (the sloppy floral print and more coarse feel of the GV ones work for us right now because they are used exclusively for clean up), I need them to absorb and pick up gunk well. Would I still recommend these, though? Absolutely. Maybe appearance and texture are more important to you for a paper towels. We aren't there yet with our littles. Lol.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
H
Verified Purchase
H. Duell
Phoenix, US
★★★★★ 1
Junk
Just pay for the better ones, these are cheap junk. They can’t even be torn off without falling apart.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Anthony Ingram
Cuba, US
★★★★★ 5
MY DOG LOVES IT
Size: 20.0"L x 20.0"W x 6.0''TH, Style: Round, Pattern Name: Bed
MY CHIHUAHUA WON'T GET OUT OF THIS BED! she loves it! from the first moment we brought it in and put it on the floor. she gently scratches at the sides and cuddles in with her blankey and likes she's not there. ohhh... great value for the price! nice size, big enough for both of my chihuahuas to lay in comfortably. soft, but very sturdy sides, the bottom is fluffy, padded very well. the outside bottom, there is a non stick covering so the bed doesn't scootch around on tile floor, it stays put.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026
B
Verified Purchase
Bonnie Murphy
Houston, US
★★★★★ 5
It's lasted
Size: 20.0"L x 20.0"W x 6.0''TH, Style: Round, Pattern Name: Bed
I've had this bed for 5 years and it is still in great shape. Washes up in the washing machine just fine. My littlest dog absolutely loves it and is lost when our other bigger dog steals it. She barely fits in it but she loves it too. Ha! Good quality at a good price. Couldn't ask for more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
R
Verified Purchase
Robert A. Martin
San Leandro, US
★★★★★ 5
My Puppy Loves It.
Size: 20.0"L x 20.0"W x 6.0''TH, Style: Round, Pattern Name: Bed
I didn't know what to expect when I saw this advertised, but some reviews said that their puppy had chewed on it and it was still holding up with no holes. So, I decided to get it and see for myself. I have to say that my puppy loves it and chews on it and it is holding up very well. No holes yet and I suspect after all her chewing and no holes, there won't be any. Nice size for a 25 pound dog and smaller. Well built and nice looking bed. It has enough padding to make it soft for my puppy. I got it big enough, so she can grow into it, too. Well satisfied and I do recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026

recommand products