SKU: 78000618301

TGFBR2 Fc Chimera Protein, Human

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TGFBR2 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2 Accession P37173 Amino Acid Sequence Thr23 Asp159, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2
Accession P37173
Amino Acid Sequence

Thr23-Asp159, with C-terminal Human IgG1 Fc TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Biros E, et al. (2011) Meta-analysis of the association between single nucleotide polymorphisms in TGF-β receptor genes and abdominal aortic aneurysm.  Atherosclerosis. 219(1):218-23.

Background

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein. TGFBR2 is comprised of a C-terminal protein kinase domain and an N-terminal ectodomain. The ectodomain consists of a compact fold containing nine beta-strands and a single helix stabilized by a network of six intra strand disulfide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.Mutations in TGFBR2 gene have been associated with Marfan syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78000618301

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chris
Belleville, US
★★★★★ 5
Gorgeous, responsive display.
I'm only a few days in, but so far this monitor is everything I hoped it would be. The unit shipped to me so far appears to be flawless, no dead pixels or other issues. The blacks are so dark that one could legitimately mistake this for an OLED monitor. (It does make my cheaper secondary monitor's blacks look awful by comparison, but that's the fault of my secondary monitor, not this one.) The resolution and frame rate of the G8 are exquisite. This is my first curved monitor. I've read that some people need time to get used to it. I was used to it almost immediately. I haven't tested the included stand. I immediately attached this monitor to a dual arm monitor stand using the included 100mm VESA mount adapter. The VESA adapter works, and attaching it was easy... however there were no screws included to attach the adapter to the monitor. This is my biggest complaint about this monitor, but it's not enough to deduct a star. Luckily I had the correct screws already, otherwise I would have had to order some. My monitor stand is only rated to 20 lbs, but has no problem handling this monitor. Maybe it goes without saying, but if you're thinking about spending the money for this monitor, make sure your PC/GPU is equipped to take advantage of it. Even in 2025 only the best GPUs are able to push 240fps at true 4K. I'm running a 7900xtx (AMD's most powerful GPU until the new ones come out this year) and so far I'm glad I spent the extra money on this monitor to unleash my GPU's potential.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2025
M
Verified Purchase
Mauricio G. Orozco
Whiting, US
★★★★★ 1
Highly recommended if you get a good copy !!
INITIAL REVIEW after 5 days : First of all, this is my rig : - AMD 7900 XTX video card - i9-12900k CPU - Z790-e mono - 32 Gb or RAM / 2TB SSD When I was checking the net about this monitor, I could not find anybody using this monitor with an AMD video card and among those who bought this monitor and hooked it up to a NVIDIA video card ( 40 series ), almost all of them coincided in two flaws about this monitor : Scan lines and flickering ( some of them reported dead pixels as well ). My initial report is that I do not have any of those issues : no scan lines in my desktop ( nor in my games ), no flickering and zero dead pixels ... however ... last Saturday December 9 when I turned on my PC ( and I would like to say something about this first : I always turn on my monitor, wait for the signal to appear in the screen - logo - and after that, I turn on my PC ... when I finish doing my gaming, I turn my PC off and then my monitor and this process is SUPER essential to keep your monitor working properly good ), I got a divided screen ( a vertical line dividing the screen in two screens ) and ugly and very pronounced scan lines in the whole screen. I freaked out and I thought in that very moment, to return it forever and replace it for a different monitor. I decided to turn not my PC, I waited 5 minutes and turned the monitor back on ... this time, I waited for the DISPLAY PORT pop up small window to show on the top left of the screen ( previously I did not wait for that logo ) and as soon as I saw that my monitor was displaying that the display port was connected, I turned my PC on and it did work as intended. Again, I do not know at this point why I got a divided screen and ugly, big and pronounced scan lines before ... I spoke to my PC tech and he suggested to me that most likely it was a cable issue. The display port cable I was using was the iVANKY 8K cable, a cable that I have for some time and was hooked up to my previous monitor and I never had any problem with it. I think that the problem probably was, that as soon as I turned on my monitor, I turned on my PC, so I did not wait for the monitor to properly wake up, give me the signal that the display port was connected and probably, that was the problem. Again, I have no technical proof about what I am saying, but the correct process should be : - Turn the monitor on and wait for a light in the screen ( energy is waking up your monitor ) and the signal that your display port is connected ... - ... and then turn on your PC ... - revert the process and this is important : once you turn off your PC and it is OFF, click on the center joystick button of your monitor, click on the 'south button' and turn the monitor off. Do not leave it on. Since that issue that happened last Saturday, I am following that process by the letter and I have not had any issue at all, however, to be sure that this does not happens again, I decided to buy a different cable in Amazon, the : BIFALE vesa certified 6.6 feet 16K DP 2.1 cable. I started to use this cable today as soon as it arrived. So far, so good. So, except for that issue that happened last Saturday and it did happen only one time, this monitor, so far, is working like a charm. Now, let's talk about some details : - The curvature : I do not know what all the fuss is about this, cause for me, is beautiful ... however, I am coming from the Samsung G7 1440p 240 Hz monitor which also is curved, so for me, that is not an issue at all, but I remember that when I got my G7, it took me a couple of days to get use to and I fell in love with curved screens. - Matte screen : I love this monitor in that regard. The screen has not reflections at all, is pure black, no light reflections and no bleeding lights at all. - The power brick is not too big as some people described it. - The bezel is thin and I like it better than my G7. - If you turn on the fancy light in the front and back, I can tell you that the lights in front are not that bright and they do not bother me as other monitors did in the past. MY OWN SETTINGS : - Refresh Rate : 240Hz ( with my GPU AMD 7900 XTX I can play Cyberpunk - no ray tracing cause I do not like it anyway - in Ultra and get 140 FPS. I do not care if it does not get to 240, cause we do not have any video card in the world that can get 240 hz in 4k anyway and beside, I do not see why people are so concerned about a lot of hertz when 60 is sufficient and if you get more than a 100 fps is more than enough. Anyway, to each his own, but for me, there is not difference between 120 or 180 FPS so I am good with what I got ... however, I got plenty of room still so when I upgrade my video ( in 2024 ) card with the newest AMD, I will probably get around 180 fps. Again, this is not something I am crazy about but it is good to have extra than not. - Free Sync : ON - Black Equalizer : 13 - Brightness : 50 - Contrast : 73 - Contrast Enhancer : OFF - Gamma : Mode 3 - Saturation : 50 - Local Dimming : AUTO - VRR Control : ON - Color Tone : CUSTOM - Red = 50 / Blue = 50 and Green = 50 - I have not used this monitor with HDR. I do have Windows 11 and I am not planning to use HDR till this feature has been enhanced by Microsoft. I do not believe it is polished enough yet so I do not know how this monitor will perform using HDR ... however, I will give it a try with new upcoming games with great graphics ( perhaps via Unreal Engine 5 ) and see how well it does perform with HDR. I will update this information once I do it next year ( 2024 ), assuming that this monitor does not break before. QUALITY OF THE SCREEN / IMAGE : - The colors are really PUNCHY ... very saturated out of the box and kind of 'warm' image, fantastic, something that you have never seen before. The only changes I made as soon as I connected it to my PC were : Refresh Rate ( default was 120Hz, Freesync = on, Black Equalizer= 13 and Gamma = mode 3. I think that the VRR was on already and Local dimming in auto as well. So out of the box this monitor is superb. I have had IPS monitors as well and nothing matched the punchy and burn colors of this monitor. I do not think that it needed to be calibrated at all. - No Scan lines - No flickering - No Dead Pixels .... I am happy so far with this monitor but I am crossing my fingers here. Someone reported in the net that he did not have any issue during 2 months and then the scan lines started to show up. We will see if that happens and if it does happen before my refund window, I will return it immediately and replace it with a different monitor but I will never go back to this one again. FLAWS : - It could be sturdy but it does wobble a bit. The base is not that strong to hold the monitor really steady. - The joystick in the bottom center of the screen to control your settings, have 5 very tiny buttons, one in the center and 4 : north, south, east and west .... those 4 are so small that in the beginning, when I try to access my monitor settings, I could not figure it out by the touch, I spent about a couple of minutes before I could sense with the tip of my finger, that there were another 4 buttons beside the middle one. In this regard, they could have done better but once you figure it out, it is easy to handle. CONCLUSION : I cannot find anything else bad in this monitor to be honest. I am not using the Display Port cable that came with it. I am using my own display port cable. I cannot advise anything related about how good this monitor is with a NVIDIA video card. All my life I used NVIDIA since I started to use PC : 1080ti and 2080ti ... I wanted to jump to the 3080 or 4080 but hey, those prices back then were too high. I will stay with AMD, which is cheaper and I have no complains at all about this awesome video card ( 7900 XTX ). My monitor is on my very nice desk ( real wood desk and heavy ) and beside me, on my right, there is the windows that give me access to my balcony. If I open it, still this monitor does not reflect light in the screen but most of time, that window stays close. I have a living room lamp on my left and a small desk lamp on the right of my desk and those lights does not reflect in my screen as well, so the matte coated Samsung used on this screen is something else. The firmware version is : 1000.8 which is the last one available according to Samsung website, so I do not need to update it at all. Well folks, for those who have an AMD card ( series 6 or 7 ), most likely, you will not have any issues with this monitor. I am saying this because I know that Samsung said that it was Nvidia fault about the scan lines and flickering in this monitor. Even though I am rating this monitor with 5 stars in Gaming, Picture Quality and Brightness, I cannot give it an overall 5 stars cause I have not used it long enough to find out if those issues that everybody have reported ( scan lines and flickering ) will show up one of these days. I hope not and if it does not happen, then I will increase my own rating to 5 overall. I will update this review in 2 weeks and a couple of days before my refund window close. Honestly, I am looking forward to continue using this monitor for a very long time. It does has the potential to still be very good in the future and has nothing to envy to any monitor out there, even an OLED monitor which are much better in the contrast department but still, this Samsung Neo G8 32" 4k 240Hz is excellent in that regard as well, and the OLED technology is not yet solid enough to completely defeat this monitor. UPDATE ( 12/24/2023 ) : Up to this point, this monitor continuos performing flawless. No scan-lines, no flickering and no dead pixels at all. I am very happy with it and will update this review in about 2 weeks. UPDATE ( 12/30/2023 ) : The image shows what this monitor has done twice since I bought it. I have tried 2 very good cables. If that happens again, I will return it. LAST UPDATE and RETURNED ( 01/03/2024 ) : Unfortunately, the ugly scan lines + divided screen ( as you can see in the image ) were present again. I had to return it today January 4th, 2024 for a full refund ( Amazon did not offer me to replace it ... ) to my credit card. It is a shame, a waste of time when you buy an expensive monitor like this one, and you end up returning the unit due to some faulty function that could not be fixed by Samsung. Yes, the monitor size is excellent, the curvature is awesome, the colors are punchy and it is a 4k screen with super detailed image but .... the scan lines ( as shown in the image ) completely ruined my experience and my desire to buy a replacement. I used 3 different cables to filter the issue, believing that the culprit was probably a bad cable but it was not. I am not an Electronic Enigineer but I think that the problem is I think, related to the display port not able to output the right frequency or something like that. Whatever you see in that picture happened 3 times in less than a month. When it happened, I had to turn my PC off and restart it back up. Anytime I did that, the monitor worked as expected, but as I said before, it did happen 3 times and that is unacceptable. I cannot keep a monitor that is doing that with the potential to completely break down to the point that I would not be able to use it anymore or ending up in sending the unit to Samsung. Why should I waste my time and why should I deal with Samsung in the first place ? If Samsung would have ensured that these units were working as expected, this would be the monitor to buy and never look back. There is no other better option than these monitors out there if you have an excellent copy. I cannot recommend to anyone to buy it cause there is a great chance that you will end up returning the unit and that is a waste of time that customers should not face at all. Now I need to wait for my full refund and will probably buy a different unit. I have time to do my research and I am very sure that I will get something better. I have changed my overall rating from 4 to 1. Good luck if you get a perfect unit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2023
S
Verified Purchase
SoxKeepYouWarm
Whiting, US
★★★★★ 5
Great high contrast gaming monitor
Great high contrast gaming monitor. I think they oversell some of the features and try to push the monitor beyond what it's really capable of but after some tweaking it's still a very good monitor I don't plan on returning. pros: - great contrast with MiniLed, almost as good as Oled* - very low latency with no noticeable overdrive - hdr looks excellent with miniled setting set to "high" - great brightness if you switch the base display profile to "fps", the default is pretty dim cons: - mine has a dead pixel in the very corner, it's so close to the edge of the screen it's barely detectable even when I'm looking for it so I decided not to return - scan lines when viewing at 240hz, it's not noticeable in games but when you look at blocky solid colors (more yellows and blues) it really stands out. Hard not to notice that all the Amazon yellow buttons have horizontal lines through them. I've left mine at 120hz, don't really notice a huge difference between the two rates anyway, completely resolves the issue. - the miniled implementation likes to avoid blooming, but comes at the cost of reducing the brightness of highlights. IE: if you have a black screen you'll notice your mouse appears slightly dimmer, but the blacks are still near-black. If you switch the miniled setting to "high" you get a normal brightness mouse but some bloom. - default settings cause a good amount of black crush (black and near-blacks get pushed to no-brightness). I had to reduce the black equalizer setting down to 8 to fix this. The default setting looks more dramatic in movies but the loss of detail in dark scenes was pretty bad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2022
K
Verified Purchase
Koby
Charlottesville, US
★★★★★ 4
Nice monitor
I have had this for a little over 2 years. The only problem that has occurred a few times is that the PC display screen goes blank. I don't know the origin of this problem but it seems to be in the monitor. If I use the monitor controls, I can view the monitor settings and eventually the PC display resumes. It has happened only a few times over the 2 years. Also, the screen control buttons are a little difficult use because they are underneath the screen and cannot be seen. Just have to go by feel. Otherwise a very nice monitor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026
C
Verified Purchase
caleb me
Lake Worth, US
★★★★★ 5
Worth the hefty price tag
After considering OLED for a while and waiting for the price to drop, I finally decided to try this when on sale. I had very high expectations and was fully prepared to refund at the first sign of trouble. Lets start with the cons in my experience. 1. After setting up the monitor and looking through the settings, trying to turn the RGB LEDs on worked... for the most part. The lights on the back worked fine, on the front there are two zones that are supposed to light up also, but only one of them worked. After doing some searching apparently a simple firmware update or downgrade can fix this, so it is not a hardware issue but a software one. I do not need LEDs on a monitor anyway, especially an OLED that has those nice true blacks, so I don't want anything on to distract my eye. I turned the LEDs off completely and never card to change firmware just to be able to turn them on again. 2. The first day I setup the monitor, tested it a bit, then went to bed. The following day I turned on the monitor and after a few hours of using it I closed all my programs and went to desktop (which is a true black single color background). To my surprise the LEDs were still on, the screen looked no different from my other non OLED screens. After digging through various settings and power cycling the monitor a few times I decided to contact support. I explained my issue and got transfer once or twice through Samsung support chat before finally getting through to help. The first thing that I was asked to do was unplug the power cord that runs from the adapter box to the monitor, not from the wall to the adapter box, and not power cycling using the button on the monitor. After waiting about a minute and plugging it back in the black were true black again and I felt like an idiot. The important takeaway here is that the box will run some power to the screen even if the screen is of, so if you need to power cycle make sure you unplug the screen. After doing the reset once my pixels have remained true black where they should and have not been an issue since. Before we get to the pros is want to mention settings. There are quite a few settings of which most are helpful, just about anything you would want to change you can. The only problem is that with so many settings it can be hard to find what you're looking for sometimes. So far this is one of my only monitors to not change settings ever after setup, I have had ASUS and ACER monitors before that both will occasionally change a setting if a certain game launches or if the hdmi/vda/dp gets unplugged. Finally we have the pros. 1. OLED monitor at a PC desktop form factor. This thing looks great, it is great to watch movies and videos on, and colorful and cinematic games look amazing, I have never seen a non OLED come anywhere close it is not even the same ballgame. I have had TN VA and IPS displays before and IMO all three of those look far more similar to each other than to this. 2. Responsiveness and Refresh rate. 240hz is incredibly solid for modern gaming, not as bug of jump from 60 to 144 or even 120, but still noticeable. Due to the OLED tech the overall screen response time is insane, it isn't as simple as the 1ms, 0.5ms or 0.1ms that you see advertised on these monitor pages, if you look into it in depth, this monitor has a response time that is about 2x faster then the next best non OLED gaming monitor, and that monitor is even 360hz! What does this meant though? Blur essentially does not exist on this monitor, comparing to 144hz, 165, and 60hz, when setting this monitors refresh rate to match, it is significantly clearer and less blurry. At 240hz even taking a still image with a high fps camera it is hard to detect or extremely minimal, where my VA 165hz displays at least 5 clearly visible ghosted images at once just with my phone camera. To summarize, this monitor I expected to be good but not worth the price tag, but after quite some use it has completely blown me away and I am definitely keeping it. The only monitor jump that has been as noticeable as jumping from non OLED to OLED is the jump from 60-144hz.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2023

recommand products