SKU: 81072197094

Human CD86, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD86, His tagProduct Specification Species Human Synonyms Activation B7 2 antigen, B70, BU63, CTLA 4 counter receptor B7. 2, FUN 1, CD28LG2 Accession P42081 Amino Acid Sequence Protein sequence (P42081, Ala24 Pro247, with C 10*His)

Product Specification


Species Human
Synonyms Activation B7-2 antigen, B70, BU63, CTLA-4 counter-receptor B7.2, FUN-1, CD28LG2
Accession P42081
Amino Acid Sequence

Protein sequence (P42081, Ala24-Pro247, with C-10*His) APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 27.2 kDa Observed MW: 40-55 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein constitutively expressed on dendritic cells, Langerhans cells, macrophages, B-cells (including memory B-cells), and on other antigen-presenting cells. Along with CD80, CD86 provides costimulatory signals necessary for T cell activation and survival. Depending on the ligand bound, CD86 can signal for self-regulation and cell-cell association, or for attenuation of regulation and cell-cell disassociation. When bound to CTLA-4, CD86 can be removed from the surface of an APC and onto the Treg cell in a process called trogocytosis. Blocking this process with anti-CTLA-4 antibodies is useful for a specific type of cancer immunotherapy called "Cancer therapy by inhibition of negative immune regulation".

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81072197094

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeff L Unruh
Cuba, US
★★★★★ 4
Good price, easy to install
Color: Warm
First, the price is right. It is easy to install. My biggest problem was within a few hours, one of the bulbs already burned out. We are still using it and the rest work great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2024
P
Verified Purchase
Peggy Gray
Belleville, US
★★★★★ 5
Great Invention
Color: White, Color: White
So simple to install and we absolutely love having this light on our patio table. You can adjust this light anywhere on the pole and direct the lights to shine up or down depending on your preference. It also has three settings. It is well made and runs on 4 AA batteries. This is a great invention and several people that have seen this light have ordered one for their own patio tables.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 18, 2023
A
Verified Purchase
Amazon Customer
Waukegan, US
★★★★★ 5
Bright, easy to use
Color: White
Love that you have different light settings. Perfect lighting. Fit easy and perfect. Only downfall is you need 4 batteries. Not had it long enough to know how long it will last. Would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2023
T
Verified Purchase
tel
Omaha, US
★★★★★ 5
Brite light fits umbrella well.
Color: White
Great little light, lights up the table great. much better price than the local department stores. time will tell how it holds up but it seems to be built fairly well, also time will tell how long the 4 AA batteries last before they will need changed but all in all I am happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2024
T
Verified Purchase
TW in New York
San Leandro, US
★★★★★ 5
Very Bright, Easy to Put Up / Take Down
Color: White, Color: White
This light is very bright, and more than meets our needs. In addition, it has a nice easy to use latch that allows you to quickly put it on and take it off. It takes 4 batteries, which is a bit more than most, but given the brightness and number of LEDs, it seems to make sense. So far, we’re beyond thrilled to have such an affordable option that made our patio more usable at night.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2021

recommand products