SKU: 81453103433

Epididymis Protein 4(HE4) His Tag Protein, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Epididymis Protein 4(HE4) His Tag Protein, HumanProduct Specification Species Human Synonyms Epididymis 4(HE4); WAP Four Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5 Accession Q14508 Amino Acid Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH Expression System HEK293 Molecular Weight major bands at 19 kDa and 22 26 kDa

Product Specification


Species Human
Synonyms Epididymis 4(HE4);WAP Four-Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5
Accession Q14508
Amino Acid Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH
Expression System HEK293
Molecular Weight major bands at 19 kDa and 22-26 kDa respectively which are due to post-translational modifications.
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human epididymal protein 4 (HE4) belongs to the whey acidic 4-disulfide center (WFDC) protein family and has the characteristics of suspected trypsin inhibitors. Mature human HE4 contains 94 amino acids (aa) and consists of two core structures: a natural N-terminal glycosylated protein of about 25KDa and two core regions of whey acidic protein (WAP, which consists of four disulfide core regions and eight cysteine residues). WFDC2 / HE4 can undergo a series of complex alternative splicing events and may produce five different protein subtypes containing WAP domains. It is expressed in many normal tissues, including the male reproductive system, respiratory region and nasopharynx. It is highly expressed in ovarian, colon, breast, lung, kidney and other tumor cell lines.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81453103433

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steve
Waukegan, US
★★★★★ 5
Fits great
Great fit
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
R
Verified Purchase
richard hunter
West Palm Beach, US
★★★★★ 5
Cabin air filter for Honda
Cabin air filter was an exact fit and arrived the next day. Seems to be of comparable quality to OEM part and was significantly cheaper.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
M
Verified Purchase
Miguel
Los Angeles, US
★★★★★ 5
Super perfecto
Perfecto
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
B
Boer
Carnegie, US
★★★★★ 5
Quick and easy to install
This review is for the INFISTAR AC85111 Cabin Air Filter. To be honest, when I saw this product I was a bit perplexed as to whether our car (Honda Odyssey) even had one! I have never replaced a cabin air filter on any car before. The mechanics might have done so during regular service, but I was not aware of it and had to do an internet search to find out where it would even be installed. Just because of my ignorance, I decided to get it and educate myself. My car actually DID have one and installation would have been a quick and easy job if I remembered to take all the heavy stuff (manuals, etc.) out of the glove box. Because I did not do it, it unhooked it on the right and I had quite a bit of trouble realigning it. If it hadn't been for that, installation would have only take a couple of minutes as it was a breeze. The new filter looks like a good quality product and will last a while. Jury is still out for me on the color though. The old filter was white, so it was easy to see the dirt it trapped. This new filter is almost dirt color which would make it harder to see how dirty it is. However, at such an affordable price, I can replace it as often as I want. I asked my mechanic about it and he said he only replaces cabin air filters if the customer requests it or if he notices a funny odor in the car.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
D
Deval
Cuba, US
★★★★★ 5
Effective Cabin Air Filter – Fresh and Clean Air for My Car
I recently replaced my car’s cabin air filter with the AC85111 activated carbon filter, and I’ve noticed a clear improvement in air quality inside the vehicle. It helps keep the cabin air fresh, especially during daily commutes and long drives. The activated carbon layer does a good job of reducing dust, odors, and outside pollution, making the driving experience more comfortable. I also noticed less smell from traffic fumes and general road dust entering the car. The fit was perfect for my Honda Pilot, and installation was simple without needing any special tools. It is compatible with several Honda and Acura models, which makes it a reliable replacement option. The material feels well-made and sturdy enough for regular use, ensuring consistent airflow while filtering out impurities effectively. Considering its performance and durability, it also offers good value for money. Overall, this is a practical, easy-to-install, and reliable cabin air filter that helps maintain cleaner and fresher air inside the car.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products