Pay in installments of $31.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Angiotensin Converting Enzyme 1 Protein, His tagProduct Specification Species Human Synonyms Angiotensin converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1 Accession P12821 Amino Acid Sequence Protein sequence (P12821, Pro631 Arg1232, with C His tag)
Product Specification
| Species | Human |
| Synonyms | Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1 |
| Accession | P12821 |
| Amino Acid Sequence | Protein sequence (P12821, Pro631-Arg1232, with C-His tag) PLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSAR |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 71.1 kDa Observed MW: 95 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Angiotensin - converting enzyme (ACE) is a crucial enzyme in the body's renin - angiotensin - aldosterone system (RAAS). It plays a key role in regulating blood pressure and fluid balance. ACE is mainly found in the lungs, but is also present in other tissues. Functionally, ACE converts angiotensin I into angiotensin II, a powerful vasoconstrictor. Angiotensin II causes blood vessels to narrow, increasing peripheral resistance and thus raising blood pressure. Additionally, it stimulates the release of aldosterone from the adrenal glands, which promotes sodium and water reabsorption in the kidneys, further contributing to blood volume and pressure regulation. Dysregulation of ACE activity can lead to hypertension and other cardiovascular disorders, making it an important target for drugs like ACE inhibitors in treating such conditions.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy