SKU: 83220555241

Human EPO Protein, hFc Tag

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human EPO Protein, hFc TagProduct Specification Species Human Synonyms Erythropoietin Accession P01588 Amino Acid Sequence Protein sequence (P01588, Ala28 Arg193, with N hFc tag) APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Expression System HEK293 Molecular Weight Predicted MW: 45. 3 kDa Observed MW: 60 70 kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms Erythropoietin
Accession P01588
Amino Acid Sequence

Protein sequence (P01588, Ala28-Arg193, with N-hFc tag) APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Expression System HEK293
Molecular Weight Predicted MW: 45.3 kDa Observed MW: 60-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Erythropoietin (EPO) is a glycoprotein hormone primarily produced by the kidneys in response to hypoxia. It stimulates red blood cell production (erythropoiesis) in the bone marrow by binding to the EPO receptor on progenitor cells. Clinically, recombinant human EPO (rhEPO) treats anemia associated with chronic kidney disease and chemotherapy. Beyond hematopoiesis, EPO exhibits tissue-protective effects in the brain and heart.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83220555241

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
n.b.
Draper, US
★★★★★ 5
PlayStation 5 is a beast
Style: PS5 Disc, Configuration: Console only
I never thought I would be a gamer at 62yrs old but after playing the PlayStation 5 at my cousins home & seeing the great graphics ,the choice of all the different types of games available for anyone's & everyone's interest, I had to have one. Are they expensive? Yeppers! But, they are well worth it as this will last for many many years, even if I wind up in a retirement home, this will come with me & I will never be bored. I might drive someone else "Batty" ( if I have a room mate he wont be there for long but thems the breaks kid!) This was purchased at an absolute excellent price & I am very thankful. Delivery was fast & on time. Thank you
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
B
Verified Purchase
Blueking
New York, US
★★★★★ 5
Wish I invested in the Playstation 5 sooner
Style: PS5 Disc, Configuration: Console only
Before buying this I had the Switch 2 and Xbox Series X; however, after buying the Playstation 5 I am blown away right out of the box. The Series X and PS5 are both 4K next generation systems, and though the Series X has the 12 teraflops graphics processing the PS5 looked way batter on my 4K TV. I also like the added functionality of the controller adding to the gaming experience with the touch pad, microphone, and gyroscopic motion control. The console is even turns on automatically by changing TV to the system's HDMI input and puts the TV into gaming mode. That is something the Series X and Switch 2 of course never have done. One down side is the system is notorious for not supporting audio cds which going back the original Playstation in 1994 the brand was always able to support. Plus if you get a cd stuck in the disk drive like what I did recently Sony made it possible to remove the disk without destroying you console in a few easy to follow steps. That saves gamers alot of money in repairs if something like that were to ever occur which is a well thought out solution. With former Xbox exclusives moving to the Playstation 5 I highly recommend adding this system to your collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
O
Verified Purchase
OKCSteve1
Los Angeles, US
★★★★★ 5
Color me impressed!
Compact, high quality unit, SUPER easy ink refills, great value, fast print and good color. I've lived with 2 printers and moved them between 5 states. A laser printer for good, fast, low cost prints and an all in one ink jet. It was a total pain, they were both big, both have me headaches, heavy and I needed 2. FINALLY, FINALLY I have 1 printer to replace both, do anything I might need and the ink refills MAKE SENSE! Imagine that?! Haha. A printer that doesn't come with just enough ink to print a test page, but comes with 2 full years with of COLOR ink! This is the way forward and thank you HP for going this route. The idea that buying a new printer is cheaper than buying ink refills warms my heart because there are so many printers that end up in landfills, not to mention how much of a consumer headache it is. I will say that I had concerns regarding color print quality and that it might be messy to refill. I'll put your mind at ease - impressive color print quality, speed and adding ink couldn't be easier! (Idk how this printer would travel while full, but everything seems tight and sealed) Overall I couldn't be happier with the end result. The cost, functions, ease of use and low ongoing ink cost are 100% with it in my opinion. I forgot to mention that I've never found a personal or work printer that was easy to use wirelessly. I'd have a headache adding the printer to my PC or couldn't get a crappy app to work. Once I did, I'd get error codes or a jam... Idk, I'm very techy but that's been my experience. This HP worked without issue and the app was very straightforward. I haven't tried advanced options but it does what I need... It just works! I did try scanning and they was fast and easy as well. I have the printer on a 6ft hutch, so fingers crossed everything continues to work and I won't have to bust out the step ladder 6x like I used to.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2024
J
Verified Purchase
Jordan P.
San Leandro, US
★★★★★ 5
I started my own photo printing shop
Having a printer that performs this well has been great. Setting it up was easy to do with the included instructions. I already have a color laser printer which I use all the time, and you may be wondering why I would go buy an inkjet printer. Photos. You can't print on glossy paper with a laser printer very well. All the photo paper I've purchased clearly says it's for inkjet printers. While this hasn't stopped me from trying. The results have been very poor. Especially if you want to cut the photos to specific sizes. Little bits of toner get everywhere. I've been putting off getting an inkjet because the cartridge system is too expensive and messy. I got more ink on my hands pulling the stickers off the refills than filling every tank on the HP 7602. This printer has all the features you would expect such as Wi-Fi, flatbed scanner, automatic document feeder, 2-sided printing, and even an ID card copy function. If your business provides financing this is something that would really make things easy for you. My wife and I print photos from our phone using the HP Smart app or the phone's default printing app and both produce excellent results. The photos are where you would expect them to be, and the quality is as good as getting them from the pharmacy. Like I said I have a laser printer, but I was curious how this would work just printing some regular documents. It’s not quite as fast obviously but the results are just as good. I love the user interface that is so seamlessly placed into the front bezel. Unless it’s telling you something you would never know it was there. This Printer checks a lot of boxes for me and was 100% worth the investment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2024
D
Verified Purchase
deing
Boise, US
★★★★★ 1
HP Warranty: Know this before buying; Unit malfunction in less than 5 months
UPDATE: Not even 5 months using this printer and there are problems. 1 - the printer's black ink is not working. A blank paper comes out for documents printed in black ink only. The problem: the black ink is not running through the tube that connects the blank ink tank to the ink cartridge. The tube is totally clear. 2 - The ink cartridge does not move to the center when opening the printer cover, preventing access and removal of the ink cartridge. HP Tech Support: Spent about an hour with tech support for them to tell me what I already knew - the printer is defective. HP Warranty: HP is not abiding by the terms of the warranty. According to the standard warranty, HP is to first ship a replacement. To ship the defected unit back, the customer is to use the prepaid shipping label provided by HP and use the box of the replacement unit to ship the defective unit back. Without any advance notification to the customers, HP has indicated to me that this policy does not apply to Smart Tank printers. Smart Tank purchasers are responsible to bear the cost of shipping the defective unit and providing the box. Once HP receives the defective unit, they will then ship the replacement. This policy obviously extends the period the customer is without a working printer. I tried pushing back, but to no avail. Replaced a HP Officejet Pro 8600 printer. The HP 7602 takes up less space, is well made, looks nice and the printing quality is better. The printing speed is slower, which will be much more noticeable when printing multiple, double sided pages. The paper tray does not have a slider from the top to ensure that the paper stays level and in place. It only has sliders on the side. I would have liked to see an Officejet Pro 8600 equivalent tank printer. The cost of ink cartridges for regular inkjet printers can not be justified for someone that does not print much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2025

recommand products