SKU: 83677819918

Human LECT2, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Pay in installments of $48.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human LECT2, His tagProduct Specification Species Human Synonyms Leukocyte cell derived chemotaxin 2, LECT 2, hLECT2 Accession O14960 Amino Acid Sequence Protein sequence (O14960, Gly19 Leu151, with C 10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 3 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms Leukocyte cell-derived chemotaxin-2, LECT-2, hLECT2
Accession O14960
Amino Acid Sequence

Protein sequence (O14960, Gly19-Leu151, with C-10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.3 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukocyte cell-derived chemotaxin-2 (LECT2) is a chemotactic factor for neutrophils. Subsequent studies have defined LECT2 as a hepatokine. LECT is an evolutionary conserved protein, has one or more important functions, and may be involved in various diseases. Human LECT2 is a secreted, 16 kilodalton protein. Its structure is similar to that of the M23 family of metalloendopeptidases. LECT2 has not been found to possess enzymatic activity and does not appear to share any functions with M23 metalloendopeptidases. The liver hepatocyte is considered to be the source of the LECT2 circulating in blood. Several cell types or tissues, e.g. osteoblasts, chondrocytes, cardiac tissue, gastrointestinal smooth muscle cells, and epithelial cells of some tissues normally do not express LECT2 but do so under a variety of disease conditions. LECT2 amyloidosis (ALECT2) was the common (~3% of total) cause of amyloidosis. Circulating levels of LECT2 are elevated in >90% of individuals with hepatoblastoma and >20% of individuals with Hepatocellular carcinoma. In the latter form of liver cancer, LECT2 levels increase with increasingly poor prognostic stages of the disease and therefore may prove to be valuable prognostic markers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83677819918

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Bryanna Brown
Cuba, US
★★★★★ 5
Swarovski Women's Sk6002 Oval Sunglasses
Color: Dark Green/Azure Internal Mirrored Silver, Lens Width: 53 Millimeters
Soooo beautiful and stylish. Great for a pop of color this winter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2023
W
Writing and Shopping
San Leandro, US
★★★★★ 5
Super cute
Color: Pink/Pink Mirrored Pink, Lens Width: 53 Millimeters
These are sturdy and super cute
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2023
R
RedRedHead
Carnegie, US
★★★★★ 5
Gorgeous!!
Color: Black/Dark Grey, Lens Width: 53 Millimeters
My new favorite sunglasses! Love the design and shape of these, they’re high quality and well made. Easily and securely fit my small framed face well and look so good on. I’ve gotten a ton of compliments and plan to purchase a second pair for my daughter who also loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2023
U
UnderdogMom
New York, US
★★★★★ 4
beautiful color and style
Color: Dark Green/Azure Internal Mirrored Silver, Lens Width: 53 Millimeters, Color: Dark Green/Azure Internal Mirrored Silver, Lens Width: 53 Millimeters
These are really beautiful sunglasses, with a thick, sturdy green frame and gorgeous emerald green crystal accents at the temples. The hinge is set inside the crystal, so when you fold the glasses, the crystal splits into two parts. It's a neat feature and really unique. The lenses are green but lightly mirrored. I love the style and color of these glasses, as they are definitely unusual and people will notice them. They are, unfortunately, a little tight on my head. I am going to take them to my optician and see if they can be adjusted. I also believe these may have been tried on or used and returned, as the lenses are both smudged like someone handled them with dirty hands. The glasses do not seem to be damaged, but I would have expected a pristine pair at this price point. They come with paperwork and a lens cloth, along with a case for carrying and storage. Paperwork says they are made by Luxottica, which is a high-end, luxury eyewear company in Milan, Italy, that owns or licenses many popular luxury eyewear brands. They are lovely glasses with very good quality, a fun upscale look, and tons of style. I like them a lot and expect many compliments on this eye-catching pair!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2023
S
Sami Joe
Bozeman, US
★★★★★ 4
Super cute
Color: Pink/Pink Mirrored Pink, Lens Width: 53 Millimeters
These are super cute and really love them except they are a tad too heavy I think for glasses. Made very well with quality materials, I found no cosmetic imperfections on the glasses. The overall look and stye of these are great and I really do love them I just can't wear them for too long due to the weight it becomes irritating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2024

recommand products