SKU: 84685548399

Human CEA, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CEA, His TagProduct Specification Species Human Accession P06731 Amino Acid Sequence Protein sequence (P06731,CEAM 5, Lys35 Ser680, with C 10*His)

Product Specification


Species Human
Accession P06731
Amino Acid Sequence

Protein sequence (P06731,CEAM-5, Lys35-Ser680, with C-10*His)


KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 72.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

CEA (carcinoembryonic antigen) is an acidic glycoprotein with the characteristics of human embryo antigen. It exists on the surface of cancer cells derived from endodermal cells and is a structural protein of cell membrane. This protein is formed in the cytoplasm and secreted into the surrounding body fluids. Therefore, it can be detected in various body fluids and excreta such as serum, cerebrospinal fluid, breast milk, gastric juice, pleural and abdominal fluid, urine and feces. As a specific marker for the early diagnosis of colon and rectal cancer, CEA level is found to increase not only in gastrointestinal malignancies, but also in serum of breast cancer, lung cancer and other malignancies through a large number of clinical practices.Therefore, CEA is a broad-spectrum tumor marker. Although it cannot be used as a specific index for the diagnosis of certain malignant tumors, it still has important clinical value in the differential diagnosis, disease monitoring and efficacy evaluation of malignant tumors.This product is the recombinant human CEA protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84685548399

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kirsten Boleng
Whiting, US
★★★★★ 3
Cute hat but a little big
Size: One Size, Color: (015) Halo Gray / / Astro Pink
Nice hat, fits a little big. lightweight and great fabric quality. I just need a hat that fits perfectly or I'm not comfortable. this one was a little big on the top.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025
L
Verified Purchase
LilCandle
Belleville, US
★★★★★ 5
Headbands that don't slip
Size: One Size, Color: (601) Red / / White
These headbands are amazing! They actually stay in place and don’t slip off my head like so many others I’ve tried. I also love that they come in multiple colors, so I can match them with different outfits. Comfortable, stylish, and practical—highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
R
Verified Purchase
RS
Cuba, US
★★★★★ 5
So cute! Granddaughter loved it for summer camp! beautiful bright colors!
Size: One Size, Color: (601) Red / / White
So cute! Granddaughter loved it for summer camp! beautiful bright colors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2025
J
Verified Purchase
Joyce Lenhart
Houston, US
★★★★★ 5
H headbands
Size: One Size, Color: (601) Red / / White
Not too tight. Very comfortable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025
E
Verified Purchase
elena malley
Natrona Heights, US
★★★★★ 1
Don't buy
Size: One Size, Color: (601) Red / / White
Flimsy and broke immediately
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2025

recommand products