SKU: 85464738724

Human CD69 Protein, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD69 Protein, His tagProduct Specification Species Human Synonyms Early activation antigen CD69, Activation inducer molecule (AIM), BL AC P26, C type lectin domain family 2 member C, EA1, Early T cell activation antigen p60, GP32 28, Leukocyte surface antigen Leu 23, MLR 3, CLEC2C Accession Q07108 Amino Acid Sequence Protein sequence (Q07108, Ser62 Lys199, with C His tag)

Product Specification


Species Human
Synonyms Early activation antigen CD69, Activation inducer molecule (AIM), BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CLEC2C
Accession Q07108
Amino Acid Sequence

Protein sequence (Q07108, Ser62-Lys199, with C-His tag) SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Expression System HEK293
Molecular Weight Predicted MW: 17.7 kDa Observed MW: 20-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD69 (Cluster of Differentiation 69) is a human transmembrane C-Type lectin protein. It is an early activation marker that is expressed in hematopoietic stem cells, T cells, and many other cell types in the immune system. It is also implicated in T cell differentiation as well as lymphocyte retention in lymphoid organs. The activation of T lymphocytes and Natural Killer (NK) cells, both in vivo and in vitro, induces expression of CD69. This molecule, which appears to be the earliest inducible cell surface glycoprotein acquired during lymphoid activation, is involved in lymphocyte proliferation and functions as a signal-transmitting receptor in lymphocytes, including natural killer (NK) cells, and platelets.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85464738724

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Michael States
Carnegie, US
★★★★★ 5
A little-mentioned history
Format: Kindle
Captivating History has released a publication that tells of the period when Italy, under the government of Mussolini, invaded Ethiopia and overthrew the government of Haile Salassee. This war was revenge for Italy's loss against Ethiopia in 1896 but weakened Italy which helped its decision to align with Hitler. For Ethiopia, the invasion represented a major setback, as it lost its independence and became subject to Italian colonial rule until the defeat of Italy in World War II. Haile Selassie returned to Ethiopia in 1941 after the British, in alliance with Ethiopian resistance fighters, liberated the country. The Italian invasion of Ethiopia remains a significant event in African history, highlighting the consequences of colonial aggression and the limitations of international diplomacy in preventing such conflicts. It also played a role in shaping Ethiopia's determination to regain its sovereignty and become a symbol of African resistance against colonialism. This is a worthwhile read as it explores a little-known facet of African history.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 3, 2023
B
Verified Purchase
Biniam
Houston, US
★★★★★ 5
Here’s a strong Amazon-style headline for your review:

“A Clear, Engaging, and Accurate Overview of
Format: Kindle
⭐️⭐️⭐️⭐️⭐️ This book is an excellent read! It provides a well-organized and concise summary of Ethiopia’s entire history, which is no small task given the country’s rich and complex past. The writing is consistent, informative, and historically accurate, making it easy to follow and deeply engaging. I especially appreciate how it also includes insights into Eritrea’s history, offering a broader understanding of the region. I highly recommend this book to anyone seeking a solid, accessible introduction to Ethiopian and Eritrean history. Captivating History did a fantastic job!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025
A
Verified Purchase
Andy McKinney
Waukegan, US
★★★★★ 4
A compact history
Format: Paperback
Sometimes we want to take a historical subject that we know little about and get a brief gloss to learn enough to discover which parts of the subject we want to delve into at greater length. "History of Ethiopia" is exactly what we need to satisfy that desire. We get the entire history of the African nation, from the very ancient days up to this very year, 2022. naturally, we do not get many nuances. What we do get is the big picture. We know how the various periods in history fit together. From the Queen of Sheba to the nasty era of the Communist Derg, we get a little bit of everything. One irritation that I had was the coverage of the Ethiopian-Somalia war in the 1970s. The crucial role played by the Cuban army is committed entirely. On the other hand, the 1540 Portuguese expedition headed by Christopher da Gama is briefly but adequately covered. Save for the intervention of da Gama the kingdom might well have been lost. If you need a fast introduction to Ethiopia, this is a good place to begin. Captivating History, the maker, has dozens of similar books, often on specific, narrowly focuses topics.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2022
B
Verified Purchase
Bobby L.
Chelsea, US
★★★★★ 5
Good book
Format: Hardcover
Spent a year living in Ethiopia 2004 to 2005. What is have read seems very accurate. Very informative book on the history of Ethiopia.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
H
Verified Purchase
Hawk
Bozeman, US
★★★★★ 5
Ethiopia from the time when the Queen of Sheba ruled
Format: Kindle
Ethiopia has a long rich history that Captivating History managed to cover in 100 pages. This book starts out by letting us know that Ethiopia is one of the first places humans settled in. One of the first kingdoms in Ethiopia was the Kingdom of Aksum. Like most African countries, Aksum established trade routes and had the silk road running through their kingdom. The Queen of Sheba is a controversial historical leader. Many scholars believe she was queen in Ethiopia. The bible states that a queen of the south came to Israel to meet King Solomon. Historians believe that the queen of the south was in fact the Queen of Sheba. While the queen was there her and King Solomon became very close and when the Queen of Sheba returned to Ethiopia she had King Solomon's baby. Menelik I may have been King Solomon's son. Some believe that when Menelik I when to visit his father, King Solomon, Menelik returned to Ethiopia with the Ark of the Covenant. Some believe that the ark is hidden away in some Ethiopian monastery, still today. There is still a lot of Ethiopia's history left for you to learn about by reading this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2022

recommand products