SKU: 87119004019

Human L-selectin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human L-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence (P14151, Trp39 Val194, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence

Protein sequence (P14151, Trp39-Val194, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.9 kDa Observed MW: 24, 26-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. It is cleaved by ADAM17. L-selectin expressed on CD4 T lymphocytes has been implicated in mediating adhesion and entry of HIV. Deficiency epithelial expression of L-selectin ligands has been associated with infertility, while increased expression has been implicated in ectopic pregnancies. The adhesive properties of L-selectin have been shown to contribute to cancer progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87119004019

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BGRLZRK
Belleville, US
★★★★★ 4
Looks and feels AMAZING! Better than the ad.
Color: purple, Color: purple
Recap... After a few months... The wheel is still Flufftabulous... There's a lot of lint accumulation on the dash and areas around the wheel but nothing like the shedding of my previous wheel. If this one ever wears completely out which i doubt... I'd definitely re-order. It arrived the next day as promised. Vacuum sealed packaging so I opened it and brushed them out. There was minimal shedding while brushing. I was relieved since this is my 2nd fuzzy wheel ... the first was more of a shag carpet type of fur which was fluffy and fabulous but left tons of lint and dust bunnies. After 2 days there's been minimal to no shedding. It was easy to put on my standard sized steering wheel and fits snug and secure NO SLIPPING! I only gave it 4 starts because the gear shift cover could be fluffier. We'll see how it all holds up in GA heat. I'm happy with it so far, if anything changes .. I'll be back. I almost forgot... I included a pic to show the view of my dashboard isn't compromised at the position I have my s.w. in which is the highest level. If you like your wheel down in your lap, your dash won't be visible. Hope this helps... Enjoy Flufftabulous Wheel!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2018
J
Verified Purchase
Jason D. Carroll
Birmingham, US
★★★★★ 5
POLYESTER?!?!
Color: Ivory, Size: 2' x 3' (Pelt), Color: Ivory, Size: 2' x 3' (Pelt)
POLYESTER?!?! So i just bought several of these. Nice and big and fluffy, looked very clean, very nice. Cats instantly were scared/curious. The back of the skin, the wool, all looked nice, and then I noticed it had a tag on it... The tag says... 100% POLYESTER! What?!?!? This is supposed to be New Zealand Sheep Skin pelt! Shouldnt be any Polyester at all. So, just before I was about to return it, i did a small burn test. I cut off a small bunch of hair and burned it. The fire tried to light but it quickly extinguished itself. And the smell... yes... the smell told me it is REAL WOOL and the fact the fire went out right away also confirms this is not oil based. THIS IS REAL, This is NOT Polyester. I guess also a lot of ppl are returning because of the tag, so these are at a HUGE DISCOUNT!!! BUY THEM UP!!! They also came in vacuum packed bags, looked nice and kept very nice. These are excellent! See my photos, the tag, the burned bunch of hair... fire went out, i tried it three times, fire kept instantly going out... smells organic like animal hair when burned, not like oil/polyester. ENJOY!!! I PAID FOR THESE, I was not given anything here!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
D
Verified Purchase
Dee
Battle Creek, US
★★★★★ 5
Love this product!
Color: Linen, Size: 2' x 3' (Pelt)
This sheepskin elevated a boring leather couch to a luxurious sitting space! I purchased 2, one for each loveseat, as sometimes the leather is a little cold. The sheepskin with a small lumbar pillow and voila! A cozy place everyone gravitates to! The sheepskin is soft and cozy and everyone comments they want one! ha probably will get this as a couple of gifts (for those guests that said they wanted one too)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
L
Verified Purchase
Laney
Lowell, US
★★★★★ 5
Perfect sheepskin rug
Color: Ivory, Size: 2'3" x 3'5" (Large Pelt)
This sheepskin rug is fabulous! I have it over my office chair and I LOVE it. It does not shed, it stays in place and fits over the seat and up the entire back of the chair with a bit remaining to hang over the edge. My cat sleeps on it every chance he gets. Great value for the price! Just looking at it brings me joy, such a beautiful sheepskin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
F
Verified Purchase
FRECKLEFRACK
West Palm Beach, US
★★★★★ 5
Dog ignores, but I like
Color: Ivory, Size: 2' x 3' (Pelt), Color: Ivory, Size: 2' x 3' (Pelt)
I bought this for my dog, who is old and has creaky joints. My dog prefers to continue resting in uncomfortable places that put my plants in peril. He does not ever recline on this dead sheep and looks at me as though I am the sheep slaughterer. Spouse asked if it came in bigger sizes. Since this is the skin of a dead sheep, it depends on live sheep girth. Anything bigger would likely have to be sewn together from multiple dead sheep. I find the girth of this sheep pelt perfectly acceptable. It is nice and thick and soft and fairly easy to vacuum. I frequently recline on it when stretched out on the floor, and am grateful it does not leave a mess or make noise like my dog, who should be grateful that his pelt is still attached to his body.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2024

recommand products