SKU: 88912597318

GPA33 His Tag Protein, Mouse

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GPA33 His Tag Protein, MouseProduct Specification Species Mouse Antigen GPA33 Synonyms Cell surface A33 antigen, Glycoprotein A33, GPA33, Glycoprotein A33 (Transmembrane), Transmembrane Glycoprotein A33, A33 Accession Q9JKA5 Amino Acid Sequence Leu22 Ile235, with C terminal 8*His

Product Specification


Species Mouse
Antigen GPA33
Synonyms Cell surface A33 antigen, Glycoprotein A33, GPA33, Glycoprotein A33 (Transmembrane), Transmembrane Glycoprotein A33, A33
Accession Q9JKA5
Amino Acid Sequence

Leu22-Ile235, with C-terminal 8*His LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNIGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Heath, J. K. , White, S. J. , Johnstone, C. N. , Catimel, B. , Simpson, R. J. , Moritz, R. L. , Tu, G. F. , et al. The human A33 antigen is a transmembrane glycoprotein and a novel member of the immunoglobulin superfamily. Proc. Natl. Acad. Sci. U. S. A. 1997. 94: 469-474.

Background

Glycoprotein A33 (GPA33) is also known as Cell surface A33 antigen, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers.GPA33 has high homology with CD2 and contains a V‐type Ig‐like domain at the N terminus. It is also related to proteins that have inhibitory roles in T cell activation, such as CD276 (B7‐H3) and VSIG4 and several cell adhesion molecules, such as CEACAM, ICAM, and NCAM (3D‐Protein BLAST, NCBI). Although its molecular function is not known, GPA33 has been associated with immune dysregulation. GPA33 may play a role in cell-cell recognition and signaling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 88912597318

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
k. oakes
Pawtucket, US
★★★★★ 4
Nice tool, but with a 4 year life span.
I bought this on Nov. 2020, after hand surgery left me temporarily unable to do simple yet necessary tasks- like opening a wine bottle. 🤪 It's compact, nicely designed, and reliable. I kept it plugged in all the time with no issues. The only negative so far is the blue light which stays on whenever the unit is in the base, fully charged or not. (Not a fan of the many small yet bright lights from all appliances! Placing a Talking Yoda figurine in front of it blocked enough of the light to satisfy me). I found it easy to use and appreciated the foil cutter. Worked well on all types of corks. Flash forward to spring 2024... Despite the constant charging, the corkscrew dies at maybe a half inch into the cork. Just slows down and dies. Having read earlier reviews, I may try to crack it open and replace the battery. But ultimately, having regained my hand strength back, I'm more likely to go back to an old fashioned, reliable, hand operated corkscrew and celebrate the loss of weird lights and needed electricity. Conclusion: unless you are recovering from hand surgery, just get a good quality non- electric corkscrew and use it for 75 years (optimistically). Best deal ever. And you can take it camping too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2024
D
Verified Purchase
Divya
San Leandro, US
★★★★★ 5
Game Changer for Wine Lovers
Color: 8-in-1 Silver, Size: Rechargeable
Circle Joy Electric Wine Bottle Opener and I’m honestly really impressed. Setup was super simple, and it works exactly as advertised—just place it on the bottle, press a button, and the cork comes out smoothly in seconds. No struggling, no broken corks, and no mess. It makes opening wine feel effortless and a lot more enjoyable. I also love the sleek design—it looks modern and feels sturdy, not cheap. If you have the set with accessories, the extras like the foil cutter and pourer are a nice bonus and actually useful. Overall, this is a great little gadget, especially if you open wine often or just want something convenient and easy to use. Definitely a solid buy or even a nice gift idea.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
B
Verified Purchase
Bruce Dresser
Houston, US
★★★★★ 5
Great electric corkscrew
Color: 7-in-1 Silver, Size: Rechargeable
The electric corkscrew works perfectly. It makes opening wine bottles so easy. I haven’t had to recharge the device for weeks!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
K
Verified Purchase
Kathleen D.
Battle Creek, US
★★★★★ 5
Best cork remover!
Color: 7-in-1 Silver, Size: Rechargeable
I love this wine bottle opener. With just a zip, the cork is out! No struggling, no breaking of the cork. Perfect. I’ve bought several for gifts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
G
Verified Purchase
Gordon Butler
Los Angeles, US
★★★★★ 5
Wine Made Easy
Color: 7-in-1 Silver, Size: Rechargeable
Excellent product and welcome addition to my kitchen. Wine opening made super easy and looks fantastic !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026

recommand products