SKU: 90015361940

CD34 Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD34 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD34 Synonyms CD34 Molecule, CD34 Antigen, Hematopoietic Progenitor Cell Antigen CD34 Accession P28906 1 Amino Acid Sequence Ser32 Thr290, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen CD34
Synonyms CD34 Molecule, CD34 Antigen, Hematopoietic Progenitor Cell Antigen CD34
Accession P28906-1
Amino Acid Sequence

Ser32-Thr290, with C-terminal Human IgG1 Fc SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 72-100kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Civin C.I. et al. (1984) J. Immunol. 133:157. 2. Katz F. et al. (1985) Leuk. Res. 9:191. 3. Andrews R.G. et al. (1986) Blood 67:842.

Background

Cluster of Differentiation 34 (CD34) is a member of a family of single-pass transmembrane sialomucin proteins, and may function as a cell-cell adhesion factor by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.CD34 protein is selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. It has been widely used as a stem and progenitor cell marker, and clinical CD34+ stem cell transplantation (CD34+SCT) has been performed for tumor purging. CD34 monoclonal antibodies are widely used to identify and isolate hemopoietic progenitors and to classify acute and chronic leukemias.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90015361940

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Casey
Phoenix, US
★★★★★ 5
Amazing!
Equick Cloud Slides Shoes have completely revolutionized my comfort and style game! From the moment I slipped them on, I knew I had found something truly exceptional. These shoes have exceeded my expectations in every possible way, making me a dedicated fan of the brand. First and foremost, the comfort level of Equick Cloud Slides Shoes is simply unparalleled. The cloud-like cushioning and supportive design make every step feel like I'm walking on air. Whether I'm strolling around the city, running errands, or even tackling a day full of meetings, these shoes provide an incredible level of comfort that keeps my feet happy and energized throughout the day. The lightweight construction is another standout feature. Equick has mastered the art of creating shoes that feel almost weightless on your feet. This not only enhances the overall comfort but also makes them incredibly convenient to carry around when traveling. I no longer have to compromise between comfort and style; these shoes offer the best of both worlds. Speaking of style, Equick Cloud Slides Shoes are a fashion statement in themselves. The sleek and modern design, combined with a range of attractive color options, ensures that you can effortlessly pair them with any outfit. Whether I'm dressing casually or aiming for a more sophisticated look, these shoes always add that perfect touch of style to my ensemble. Durability is yet another area where Equick Cloud Slides Shoes shine. Despite frequent use and various terrains, they have held up remarkably well. The quality materials and craftsmanship are evident in every aspect of these shoes, making them a reliable and long-lasting investment. Finally, I must commend Equick's customer service. They are a pleasure to interact with, always responsive and attentive to any queries or concerns. It's refreshing to see a company that genuinely cares about its customers' satisfaction. In conclusion, Equick Cloud Slides Shoes have completely won me over with their exceptional comfort, lightweight design, stylish appeal, durability, and outstanding customer service. These shoes are an absolute game-changer and have become an essential part of my daily routine. If you're looking for the ultimate combination of comfort and style, I wholeheartedly recommend Equick Cloud Slides Shoes. Trust me, you won't be disappointed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2023
J
Verified Purchase
Jodi Bone
Lowell, US
★★★★★ 5
Grey fit Great~ Pink too Big (Ordered same size)
This was Very unusual to have ordered 2 pair of shoes in SAME Size, one color (Grey) fit Great!! However the Pink pair were HUGE & even my daughter tried to slide right in them but they were “BOAT” shoes on her too! I love the Grey (that fit😅) as wear when I’m cleaning &/Or dressing up to go out. The Grey is very versatile in what you can wear with these. The #1 thing I LOVE that sounds Corny Ah??.. I mop my floors & I can walk across without busting my 🍑!! I walk on Water in floor & don’t even slide nor have I had to catch a cabinet on my way down!! Love these shoes soo much. Don’t know what Co but I want other colors!! Great Buy so I think I’ll do it again & buy another pair once I receive return. I truly don’t know what to tell others?.. Maybe something like: “if Pink is your Fav Color & U feel need for some pink slides than order couple sizes smaller?🤷🏼‍♀️ I ordered pink for my 21 yr old daughter who can pull off wearing any pink. shoes. I literally couldn’t take watching her wear these Pink ‘Oversized’ Boat shoes like she stole them or someone felt sorry for her looking poor & handed her the shoes off their feet.. I just RETURNED them & now have tell her to pick a color & I’ll buy her another pair (not pink). My Grey ones look Great& feel even better!! So many have asked Where I bought & never seen before. These are VERY Comfortable!! I wear them all day Into night. I need to order more colors & just 🤞🏼🤞🏼for size to be correct!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 27, 2023
S
Verified Purchase
smile
Pawtucket, US
★★★★★ 4
Comfortable
Size: 9-10 Women/7.5-8.5 Men, Color: Slide Navy-ultrasoft-version
I hope they convert this sandal into shoes. I would definitely buy them. It is so comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
L
Verified Purchase
LoveDogs
Whiting, US
★★★★★ 5
I love the metallic iridescent!
Why did you pick this product vs others?: I love the color and the feel but the sizing is wonky. I’m a perfect 7.5. The 7 wears like a 6-6.5 and the 8 is just a little too big. I’m keeping my 7 in the blue and I have a pair in wine/purple in 8 from a few years ago. I just won’t be running a mile in them anytime soon! LOL I love the look!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2025
R
Verified Purchase
Renee Wilson
Houston, US
★★★★★ 5
Soft and comfortable
Great to slip on after being outside
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products