SKU: 90332623770

Human h-FABP3, His Tag

Sale price$168.75 Regular price$187.50
Save 10%

Pay in installments of $46.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human h-FABP3, His TagProduct Specification Species Human Synonyms Fatty acid binding protein 3, Heart type fatty acid binding protein (H FABP), Mammary derived growth inhibitor (MDGI), Muscle fatty acid binding protein (M FABP) Accession P05413 Amino Acid Sequence Protein sequence(P05413, Met1 Ala133 with C 10*His) MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEAGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Fatty acid-binding protein 3, Heart-type fatty acid-binding protein (H-FABP), Mammary-derived growth inhibitor (MDGI), Muscle fatty acid-binding protein (M-FABP)
Accession P05413
Amino Acid Sequence

Protein sequence(P05413, Met1-Ala133 with C-10*His)


MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 16.5kDa Actual: 18kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Heart-type fatty acid binding protein (hFABP) also known as mammary-derived growth inhibitor is a protein that in humans is encoded by the FABP3 gene. Heart-type Fatty Acid-Binding Protein (H-FABP) is a small cytoplasmic protein (15 kDa) released from cardiac myocytes following an ischemic episode. H-FABP is a sensitive biomarker for myocardial infarction and can be detected in the blood within one to three hours of the pain. In addition to its diagnostic potential, H-FABP also has prognostic value. Alongside D-dimer, NT-proBNP and peak troponin T, it was the only cardiac biomarker that proved to be a statistically significant predictor of death or MI at one year. This prognostic information was independent of troponin T, ECG and clinical examination.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90332623770

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Melissa
Louisville, US
★★★★★ 5
100% works, you do have to get used them, bit uncomfortable at first but so worth it.
Size: 40 Count (Pack of 1)
I wake up with my breath feeling fresh and my mouth not emulating the sahara desert. It took me a while to get use to these. I had to find a spot where it was comfortable and stayed put (for me thats right above the tooth right behind (the next one back from) the canine, pushed as far up into my gum/lip area as it can go. The size takes some getting used to also (they arent huge they just feel big once in you can still talk and go about your day as normal and no kne will notice it), however they do last all night. Once you get the hang out of they’re actually quite easy to use. I have tried both the mint (which is mild and pleasant no burning sensation and gives the freshest feeling in the morning) and the plain ones (works but being plain your mouth doesnt feel as fresh in the morning, these are great if you hate mint or worse have a mint allergy, personally I find this very thoughtful of the company) These 100% work. I dont even sleep with my mouth open (has been confirmed) and I would still wake up with the dryest of dry mouths, it gets so bad it’ll actually wake me sometimes. My mouth would hurt in the mornings because it would be so dry. Went in search of anything that could help and stumbled upon these tablets. Figured why not. So glad I did because now I put one of these in every night before bed and when I wake up my mouth isn't dry, these really do help keep your mouth salivating throughout the night. I use them during the day sometimes too. Xylitol is the only thing I've found that actually helps dry mouth. Which in turns helps your teeth stay healthy. (so win win in my book)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2025
J
Verified Purchase
JS
Bozeman, US
★★★★★ 4
Works pretty well, not sure about 8 hours during the night, seems like 4-5 hrs max
Size: 80 Count
I was having issues with dry mouth during the night as I use a CPAP. Besides checking over all the hardware and seals for my CPAP, and setting temperatures/humidity, there is only so much to control. My dry mouth was causing my cheeks and jaw to get severely dried out and would wake up with an unpleasant sticking due to the dryness. First night, I tried 1 of these on my upper molars, and it already was working wonders, but my mouth was still dry, but 80% better than the previous night without the XyliMelts. Next time I tried 2, one on each side of my lower molars, and it worked wonders! I still woke up with a little dry mouth, but it was such an improvement I will be using these every night going forward. Each XyliMelt is individually packaged, so you don't have to worry about freshness. They pop out of the foil easily, and you can set them into your gumline before they start to set. Once they set, they do stay put. Just follow the simple directions on the box and you won't have issues. I also really like that you can drink liquids after putting them in, if needed, as I often drink water before bed, or if I wake up in the middle of the night. The taste is excellent, a very, very light minty taste, enough to be good, but not overpowering and you will quickly forget about it, which is probably what you would want when using at night. The thickness of the melt itself is a little big, and I'll notice it in my mouth while falling asleep, but it isn't disruptive enough to distract you or wake you up. Overall, a super good product, although slightly expensive.I think part of that is due to a niche product, but also the packaging - which to be fair is nice, since it will keep each individual melt fresh and the breakout packs mean you can take some traveling easily without worrying about bottles etc. My only complaints in the end would be the price (I will look to buy bulk now that I know they work for me) and maybe the fact it won't last a full 7-8 hrs of sleep for me, but still highly recommended for dry mouth!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
J
Verified Purchase
JTC
Lowell, US
★★★★★ 5
Great solution for nighttime coughing.
Size: 40 Count (Pack of 3)
My dental hygienist recommended this when I told her I used a cough drop during the night bc I coughed. Obviously cough drops are not good for your teeth, and I found these serve the same purpose! They stick to the roof of your mouth & provide moisture all night long. So glad I found out about them. Pleasant taste - lasts all night.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
K
Verified Purchase
kidsfirst
Lowell, US
★★★★★ 5
These work!!!!
Size: 40 Count (Pack of 1)
I was waking up with several times a night super dry mouth even after drinking water. These tablets cured the dry mouth and now I am back to sleeping all night
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
alana
Waukegan, US
★★★★★ 3
Lasted about an hour
Size: 40 Count (Pack of 1)
Today I used my first mint flavored melt, it lasted for exactly an hour. I didn’t have super high expectations for this to last 8 hours, but want to see if it would improve my overall enamel and prevent cavities. I was hoping it could help my night time dryness from a chronic stuffy nose and sleeping with my mouth open. I placed it upper molar area, but I think it’s good even still.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products